Germany
Japan
United Kingdom
China
NAE1 (Myc-DDK-tagged)-Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
NAE1 (Myc-DDK-tagged)-Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, NAE1 (Myc-DDK tagged) - Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NAE1 (mGFP-tagged) - Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Nae1 (Myc-DDK-tagged) - Mouse NEDD8 activating enzyme E1 subunit 1 (Nae1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Nae1 (Myc-DDK-tagged) - Mouse NEDD8 activating enzyme E1 subunit 1 (Nae1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NAE1 (Myc-DDK-tagged)-Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NAE1 (GFP-tagged) - Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NAE1 (GFP-tagged) - Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NAE1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN401326 is the updated version of KN201326.
Nae1 (GFP-tagged) - Mouse amyloid beta precursor protein binding protein 1 (Appbp1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Nae1 (Myc-DDK-tagged) - Mouse NEDD8 activating enzyme E1 subunit 1 (Nae1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nae1 (Myc-DDK-tagged) - Mouse NEDD8 activating enzyme E1 subunit 1 (Nae1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Nae1 (mGFP-tagged) - Mouse NEDD8 activating enzyme E1 subunit 1 (Nae1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nae1 (GFP-tagged) - Mouse NEDD8 activating enzyme E1 subunit 1 (Nae1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, NAE1 (Myc-DDK tagged) - Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, NAE1 (mGFP-tagged) - Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NAE1 (Myc-DDK tagged) - Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NAE1 (mGFP-tagged) - Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NAE1 (Myc-DDK-tagged)-Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
6 Weeks
Lenti ORF particles, NAE1 (Myc-DDK-tagged)-Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NAE1 (mGFP-tagged)-Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
6 Weeks
Lenti ORF particles, NAE1 (mGFP-tagged)-Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NAE1 (myc-DDK-tagged) - Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NAE1 (GFP-tagged) - Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Nae1 (Myc-DDK-tagged ORF) - Rat NEDD8 activating enzyme E1 subunit 1 (Nae1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Nae1 (Myc-DDK-tagged ORF) - Rat NEDD8 activating enzyme E1 subunit 1 (Nae1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nae1 (Myc-DDK-tagged ORF) - Rat NEDD8 activating enzyme E1 subunit 1 (Nae1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Nae1 (mGFP-tagged ORF) - Rat NEDD8 activating enzyme E1 subunit 1 (Nae1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nae1 (GFP-tagged ORF) - Rat NEDD8 activating enzyme E1 subunit 1 (Nae1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NAE1 (untagged)-Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
APPBP1 rabbit polyclonal  antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NAE1 (APPBP1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 430-459 amino acids from the C-terminal region of human NAE1 (APPBP1). |
Lenti ORF clone of Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
NAE1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY418361 is the same product as LY429168.
Transient overexpression lysate of NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Nae1 (untagged) - Mouse NEDD8 activating enzyme E1 subunit 1 (Nae1), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
NAE1 (untagged)-Human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 3
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
NAE1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
Rabbit Polyclonal Anti-NAE1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Nae1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Nae1. Synthetic peptide located within the following region: ARALKEFVAKEGQGNLPVRGTIPDMIADSNKYIKLQNVYREKAKKDAAAV |
APPBP1 (1-534, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
APPBP1 (1-534, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) NAE1 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- NAE1