Products

cDNA Clones (42)
Antibodies (19)
Proteins (17)
RNAi (12)
Gene Expression (6)
Jump to Filters
View as table Download
NEK11 (NM_024800) Human Tagged ORF Clone
RC221953

USD 480.00

In Stock

NEK11 (Myc-DDK-tagged)-Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NEK11 (NM_145910) Human Tagged ORF Clone
RC223695

USD 440.00

In Stock

NEK11 (Myc-DDK-tagged)-Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NEK11 (NM_001146003) Human Tagged ORF Clone
RC228483

USD 480.00

In Stock

NEK11 (Myc-DDK-tagged)-Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NEK11 (NM_024800) Human Tagged ORF Clone Lentiviral Particle
RC221953L1V

USD 880.00

3 Weeks

Lenti ORF particles, NEK11 (Myc-DDK tagged) - Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
NEK11 (NM_024800) Human Tagged ORF Clone Lentiviral Particle
RC221953L2V

USD 880.00

6 Weeks

Lenti ORF particles, NEK11 (mGFP-tagged) - Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Nek11 (NM_172461) Mouse Tagged ORF Clone
MR218193

USD 480.00

In Stock

Nek11 (Myc-DDK-tagged) - Mouse NIMA (never in mitosis gene a)-related expressed kinase 11 (Nek11)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NEK11 (NM_024800) Human Tagged ORF Clone
RG221953

USD 530.00

In Stock

NEK11 (GFP-tagged) - Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NEK11 Human Gene Knockout Kit (CRISPR)
KN421953

USD 1,290.00

2 Weeks

NEK11 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN421953 is the updated version of KN221953.
Nek11 Mouse Gene Knockout Kit (CRISPR)
KN510885

USD 1,290.00

2 Weeks

Nek11 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN510885 is the updated version of KN310885.
Nek11 (NM_172461) Mouse Tagged ORF Clone
MG218193

USD 530.00

3 Weeks

Nek11 (GFP-tagged) - Mouse NIMA (never in mitosis gene a)-related expressed kinase 11 (Nek11), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Nek11 (NM_172461) Mouse Tagged ORF Clone
MR218193L3

USD 680.00

3 Weeks

Lenti ORF clone of Nek11 (Myc-DDK-tagged) - Mouse NIMA (never in mitosis gene a)-related expressed kinase 11 (Nek11)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nek11 (NM_172461) Mouse Tagged ORF Clone Lentiviral Particle
MR218193L3V

USD 880.00

6 Weeks

Lenti ORF particles, Nek11 (Myc-DDK-tagged) - Mouse NIMA (never in mitosis gene a)-related expressed kinase 11 (Nek11), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nek11 (NM_172461) Mouse Tagged ORF Clone
MR218193L4

USD 680.00

3 Weeks

Lenti ORF clone of Nek11 (mGFP-tagged) - Mouse NIMA (never in mitosis gene a)-related expressed kinase 11 (Nek11)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nek11 (NM_172461) Mouse Tagged ORF Clone Lentiviral Particle
MR218193L4V

USD 880.00

6 Weeks

Lenti ORF particles, Nek11 (GFP-tagged) - Mouse NIMA (never in mitosis gene a)-related expressed kinase 11 (Nek11), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NEK11 (NM_024800) Human Tagged ORF Clone
RC221953L3

USD 680.00

3 Weeks

Lenti ORF clone of Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NEK11 (NM_024800) Human Tagged ORF Clone Lentiviral Particle
RC221953L3V

USD 880.00

5 Weeks

Lenti ORF particles, NEK11 (Myc-DDK tagged) - Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NEK11 (NM_024800) Human Tagged ORF Clone
RC221953L4

USD 680.00

3 Weeks

Lenti ORF clone of Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NEK11 (NM_024800) Human Tagged ORF Clone Lentiviral Particle
RC221953L4V

USD 880.00

7 Weeks

Lenti ORF particles, NEK11 (mGFP-tagged) - Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NEK11 (NM_145910) Human Tagged ORF Clone
RC223695L3

USD 640.00

3 Weeks

Lenti-ORF clone of NEK11 (Myc-DDK-tagged)-Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NEK11 (NM_145910) Human Tagged ORF Clone Lentiviral Particle
RC223695L3V

USD 840.00

6 Weeks

Lenti ORF particles, NEK11 (Myc-DDK-tagged)-Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NEK11 (NM_145910) Human Tagged ORF Clone
RC223695L4

USD 640.00

3 Weeks

Lenti-ORF clone of NEK11 (mGFP-tagged)-Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NEK11 (NM_145910) Human Tagged ORF Clone Lentiviral Particle
RC223695L4V

USD 840.00

6 Weeks

Lenti ORF particles, NEK11 (mGFP-tagged)-Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NEK11 (NM_001146003) Human Tagged ORF Clone
RC228483L3

USD 680.00

3 Weeks

Lenti-ORF clone of NEK11 (Myc-DDK-tagged)-Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NEK11 (NM_001146003) Human Tagged ORF Clone Lentiviral Particle
RC228483L3V

USD 880.00

6 Weeks

Lenti ORF particles, NEK11 (Myc-DDK-tagged)-Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NEK11 (NM_001146003) Human Tagged ORF Clone
RC228483L4

USD 680.00

3 Weeks

Lenti-ORF clone of NEK11 (mGFP-tagged)-Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NEK11 (NM_001146003) Human Tagged ORF Clone Lentiviral Particle
RC228483L4V

USD 880.00

6 Weeks

Lenti ORF particles, NEK11 (mGFP-tagged)-Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NEK11 (NM_145910) Human Tagged ORF Clone
RG223695

USD 480.00

3 Weeks

NEK11 (GFP-tagged) - Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NEK11 (NM_001146003) Human Tagged ORF Clone
RG228483

USD 530.00

3 Weeks

NEK11 (GFP-tagged) - Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Nek11 (NM_001108182) Rat Tagged ORF Clone
RR200662

USD 690.00

5 Weeks

Nek11 (Myc-DDK-tagged ORF) - Rat NIMA (never in mitosis gene a)- related kinase 11 (Nek11), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Nek11 (NM_001108182) Rat Tagged ORF Clone
RR200662L3

USD 890.00

8 Weeks

Lenti ORF clone of Nek11 (Myc-DDK-tagged ORF) - Rat NIMA (never in mitosis gene a)- related kinase 11 (Nek11), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nek11 (NM_001108182) Rat Tagged ORF Clone Lentiviral Particle
RR200662L3V

USD 1,100.00

12 Weeks

Lenti ORF particles, Nek11 (Myc-DDK-tagged ORF) - Rat NIMA (never in mitosis gene a)- related kinase 11 (Nek11), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nek11 (NM_001108182) Rat Tagged ORF Clone
RR200662L4

USD 970.00

8 Weeks

Lenti ORF clone of Nek11 (mGFP-tagged ORF) - Rat NIMA (never in mitosis gene a)- related kinase 11 (Nek11), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nek11 (NM_001108182) Rat Tagged ORF Clone Lentiviral Particle
RR200662L4V

USD 1,240.00

12 Weeks

Lenti ORF particles, Nek11 (GFP-tagged ORF) - Rat NIMA (never in mitosis gene a)- related kinase 11 (Nek11), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NEK11 Rabbit Polyclonal Antibody
TA346831

USD 475.00

5 Days

Rabbit Polyclonal Anti-NEK11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEK11 antibody: synthetic peptide directed towards the middle region of human NEK11. Synthetic peptide located within the following region: KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMS
NEK11 (NM_024800) Human Tagged ORF Clone
RC221953L1

USD 840.00

In Stock

Lenti ORF clone of Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
NEK11 (NM_024800) Human Untagged Clone
SC111981

USD 1,090.00

In Stock

NEK11 (untagged)-Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
NEK11 (NM_024800) Human Tagged ORF Clone
RC221953L2

USD 680.00

3 Weeks

Lenti ORF clone of Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NEK11 (NM_024800) Human Untagged Clone
SC323687

USD 1,090.00

In Stock

NEK11 (untagged)-Kinase deficient mutant (K61M) of Human NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
NEK11 (NM_145910) Human Over-expression Lysate
LC407844

USD 187.00

In Stock

NEK11 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NEK11 (NM_024800) Human Over-expression Lysate
LC411057

USD 187.00

In Stock

NEK11 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NEK11 (NM_001146003) Human Over-expression Lysate
LC431511

USD 121.00

In Stock

NEK11 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NEK11 (NM_145910) Human Over-expression Lysate
LY407844

USD 605.00

In Stock

Transient overexpression lysate of NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NEK11 (NM_001146003) Human Over-expression Lysate
LY431511

USD 396.00

In Stock

Transient overexpression lysate of NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NEK11 Human siRNA Oligo Duplex (Locus ID 79858)
SR312655

USD 430.00

In Stock

NEK11 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

NEK11 Human shRNA Plasmid Kit (Locus ID 79858)
TF320734

USD 715.00

In Stock

NEK11 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector

Format Retroviral plasmids
Vector pRFP-C-RS
NEK11 (NM_024800) Human Over-expression Lysate
LY411057

USD 605.00

5 Days

Transient overexpression lysate of NIMA (never in mitosis gene a)- related kinase 11 (NEK11), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NEK11 Mouse Monoclonal Antibody [Clone ID: OTI4H5]
CF501583

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NEK11 mouse monoclonal antibody, clone OTI4H5 (formerly 4H5)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
NEK11 Mouse Monoclonal Antibody [Clone ID: OTI5E9]
CF501608

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NEK11 mouse monoclonal antibody, clone OTI5E9 (formerly 5E9)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
NEK11 Mouse Monoclonal Antibody [Clone ID: OTI5D9]
CF501765

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NEK11 mouse monoclonal antibody, clone OTI5D9 (formerly 5D9)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Human NEK11 activation kit by CRISPRa
GA112682

USD 1,290.00

2 Weeks

NEK11 CRISPRa kit - CRISPR gene activation of human NIMA related kinase 11

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector