Products

cDNA Clones (29)
RNAi (11)
Gene Expression (7)
Antibodies (4)
Proteins (3)
Jump to Filters
View as table Download
P2rx1 (NM_008771) Mouse Tagged ORF Clone
MR206258

USD 350.00

In Stock

P2rx1 (Myc-DDK-tagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2X1 (P2RX1) (NM_002558) Human Tagged ORF Clone
RC207924

USD 420.00

In Stock

P2RX1 (Myc-DDK-tagged)-Human purinergic receptor P2X, ligand-gated ion channel, 1 (P2RX1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2X1 (P2RX1) (NM_002558) Human Untagged Clone
SC118594

USD 310.00

In Stock

P2RX1 (untagged)-Human purinergic receptor P2X, ligand-gated ion channel, 1 (P2RX1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
P2X1 (P2RX1) (NM_002558) Human Tagged ORF Clone
RG207924

USD 460.00

In Stock

P2RX1 (GFP-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 1 (P2RX1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
P2X1 (P2RX1) Human Gene Knockout Kit (CRISPR)
KN407924

USD 1,290.00

2 Weeks

P2RX1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN407924 is the updated version of KN207924.
P2rx1 Mouse Gene Knockout Kit (CRISPR)
KN512708

USD 1,290.00

2 Weeks

P2rx1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN512708 is the updated version of KN312708.
P2rx1 (NM_008771) Mouse Tagged ORF Clone
MG206258

USD 390.00

3 Weeks

P2rx1 (GFP-tagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
P2rx1 (NM_008771) Mouse Tagged ORF Clone
MR206258L3

USD 550.00

3 Weeks

Lenti ORF clone of P2rx1 (Myc-DDK-tagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx1 (NM_008771) Mouse Tagged ORF Clone Lentiviral Particle
MR206258L3V

USD 750.00

6 Weeks

Lenti ORF particles, P2rx1 (Myc-DDK-tagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx1 (NM_008771) Mouse Tagged ORF Clone
MR206258L4

USD 550.00

3 Weeks

Lenti ORF clone of P2rx1 (mGFP-tagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx1 (NM_008771) Mouse Tagged ORF Clone Lentiviral Particle
MR206258L4V

USD 750.00

6 Weeks

Lenti ORF particles, P2rx1 (GFP-tagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2X1 (P2RX1) (NM_002558) Human Tagged ORF Clone
RC207924L3

USD 620.00

3 Weeks

Lenti-ORF clone of P2RX1 (Myc-DDK-tagged)-Human purinergic receptor P2X, ligand-gated ion channel, 1 (P2RX1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2X1 (P2RX1) (NM_002558) Human Tagged ORF Clone Lentiviral Particle
RC207924L3V

USD 820.00

6 Weeks

Lenti ORF particles, P2RX1 (Myc-DDK-tagged)-Human purinergic receptor P2X, ligand-gated ion channel, 1 (P2RX1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2X1 (P2RX1) (NM_002558) Human Tagged ORF Clone
RC207924L4

USD 620.00

3 Weeks

Lenti-ORF clone of P2RX1 (mGFP-tagged)-Human purinergic receptor P2X, ligand-gated ion channel, 1 (P2RX1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx1 (NM_001142367) Rat Tagged ORF Clone
RR200412

USD 420.00

4 Weeks

P2rx1 (Myc-DDK-tagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), transcript variant 2, (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2rx1 (NM_001142367) Rat Tagged ORF Clone
RR200412L3

USD 640.00

8 Weeks

Lenti ORF clone of P2rx1 (Myc-DDK-tagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), transcript variant 2, (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx1 (NM_001142367) Rat Tagged ORF Clone Lentiviral Particle
RR200412L3V

USD 850.00

12 Weeks

Lenti ORF particles, P2rx1 (Myc-DDK-tagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx1 (NM_001142367) Rat Tagged ORF Clone
RR200412L4

USD 700.00

8 Weeks

Lenti ORF clone of P2rx1 (mGFP-tagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), transcript variant 2, (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx1 (NM_001142367) Rat Tagged ORF Clone Lentiviral Particle
RR200412L4V

USD 960.00

12 Weeks

Lenti ORF particles, P2rx1 (GFP-tagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx1 (NM_012997) Rat Tagged ORF Clone
RR200413

USD 420.00

4 Weeks

P2rx1 (Myc-DDK-tagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), transcript variant 1, (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2rx1 (NM_012997) Rat Tagged ORF Clone
RR200413L3

USD 640.00

8 Weeks

Lenti ORF clone of P2rx1 (Myc-DDK-tagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), transcript variant 1, (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx1 (NM_012997) Rat Tagged ORF Clone Lentiviral Particle
RR200413L3V

USD 850.00

12 Weeks

Lenti ORF particles, P2rx1 (Myc-DDK-tagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx1 (NM_012997) Rat Tagged ORF Clone
RR200413L4

USD 700.00

8 Weeks

Lenti ORF clone of P2rx1 (mGFP-tagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), transcript variant 1, (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx1 (NM_012997) Rat Tagged ORF Clone Lentiviral Particle
RR200413L4V

USD 960.00

12 Weeks

Lenti ORF particles, P2rx1 (GFP-tagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx1 (NM_001285415) Rat Tagged ORF Clone
RR216508

USD 420.00

3 Weeks

P2rx1 (myc-DDK-tagged) - Rat purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2X1 (P2RX1) Rabbit Polyclonal Antibody
TA329003

USD 585.00

3 Weeks

Rabbit polyclonal Anti-P2X1 Receptor (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CRPIYEFHGLYEEK, corresponding to amino acid residues 270-283 of human P2X1 receptor . Extracellular loop.
P2rx1 (NM_012997) Rat Untagged Clone
RN200413

USD 420.00

In Stock

P2rx1 (untagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), transcript variant 1, (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
P2rx1 Rabbit Polyclonal Antibody
TA328991

USD 585.00

3 Weeks

Rabbit polyclonal Anti-P2X1 Receptor

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (CS)DPVATSSTLGLQENMRTS, corresponding to amino acid residues 382-399 of rat P2X1 Receptor. Intracellular, C-terminus.
P2X1 (P2RX1) Rabbit Polyclonal Antibody
TA338532

USD 310.00

5 Days

Rabbit Polyclonal Anti-P2RX1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RX1 antibody: synthetic peptide directed towards the middle region of human P2RX1. Synthetic peptide located within the following region: VVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENG
P2X1 (P2RX1) Rabbit Polyclonal Antibody
RA10107-150

USD 350.00

2 Weeks

P2X1 (P2RX1) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Rat
Conjugation Unconjugated
Human P2X1 (P2RX1) activation kit by CRISPRa
GA103352

USD 1,290.00

2 Weeks

P2RX1 CRISPRa kit - CRISPR gene activation of human purinergic receptor P2X 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse P2rx1 activation kit by CRISPRa
GA203076

USD 1,290.00

2 Weeks

P2rx1 CRISPRa kit - CRISPR gene activation of mouse purinergic receptor P2X, ligand-gated ion channel, 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
P2RX1 Human qPCR Template Standard (NM_002558)
HK205357

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene P2RX1

Application Plasmid of exact quantity for transcript copy number calculation
P2X1 (P2RX1) Human qPCR Primer Pair (NM_002558)
HP206218

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene P2RX1

P2rx1 (NM_008771) Mouse Untagged Clone
MC207343

USD 420.00

3 Weeks

P2rx1 (untagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
P2rx1 Mouse qPCR Primer Pair (NM_008771)
MP212221

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene P2rx1

P2rx1 (NM_001142367) Rat Untagged Clone
RN200412

USD 420.00

4 Weeks

P2rx1 (untagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), transcript variant 2, (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
P2rx1 (NM_001285415) Rat Untagged Clone
RN216508

USD 380.00

3 Weeks

P2rx1 (untagged) - Rat purinergic receptor P2X, ligand-gated ion channel, 1 (P2rx1), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
P2X1 (P2RX1) (NM_002558) Human 3' UTR Clone
SC213589

USD 560.00

4 Weeks

3`UTR clone of purinergic receptor P2X ligand-gated ion channel 1 (P2RX1) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
P2rx1 Mouse siRNA Oligo Duplex (Locus ID 18436)
SR413338

USD 430.00

2 Weeks

P2rx1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

P2rx1 Rat siRNA Oligo Duplex (Locus ID 25505)
SR500199

USD 430.00

2 Weeks

P2rx1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

P2X1 (P2RX1) (NM_002558) ICC Control Block
TB407924

USD 1,070.00

4 Weeks

Transient overexpression of P2RX1 (NM_002558) in HEK293T cells paraffin embedded controls for ICC/IHC staining

P2X1 (P2RX1) Human shRNA Plasmid Kit (Locus ID 5023)
TL310650

USD 815.00

2 Weeks

P2RX1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
P2X1 (P2RX1) Human shRNA Lentiviral Particle (Locus ID 5023)
TL310650V

USD 1,395.00

5 Weeks

P2RX1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
P2rx1 Mouse shRNA Plasmid (Locus ID 18436)
TL501565

USD 815.00

2 Weeks

P2rx1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
P2rx1 Mouse shRNA Lentiviral Particle (Locus ID 18436)
TL501565V

USD 1,395.00

5 Weeks

P2rx1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
P2rx1 Rat shRNA Plasmid (Locus ID 25505)
TL709603

USD 815.00

2 Weeks

P2rx1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
P2rx1 Rat shRNA Lentiviral Particle (Locus ID 25505)
TL709603V

USD 1,395.00

5 Weeks

P2rx1 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
P2X1 (P2RX1) Human shRNA Plasmid Kit (Locus ID 5023)
TR310650

USD 715.00

2 Weeks

P2RX1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS