Products

cDNA Clones (37)
RNAi (11)
Proteins (10)
Gene Expression (7)
Antibodies (4)
Jump to Filters
View as table Download
P2X6 (P2RX6) (NM_005446) Human Tagged ORF Clone
RC206536

USD 420.00

In Stock

P2RX6 (Myc-DDK-tagged)-Human purinergic receptor P2X, ligand-gated ion channel, 6 (P2RX6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
P2X6 (P2RX6) (NM_001159554) Human Tagged ORF Clone
RC228328

USD 420.00

In Stock

P2RX6 (Myc-DDK-tagged)-Human purinergic receptor P2X, ligand-gated ion channel, 6 (P2RX6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
P2rx6 (NM_011028) Mouse Tagged ORF Clone
MR224683

USD 300.00

In Stock

P2rx6 (Myc-DDK-tagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2X6 (P2RX6) (NM_005446) Human Tagged ORF Clone
RG206536

USD 460.00

In Stock

P2RX6 (GFP-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 6 (P2RX6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
P2rx6 (NM_001159561) Mouse Tagged ORF Clone
MR219240

USD 300.00

In Stock

P2rx6 (Myc-DDK-tagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2X6 (P2RX6) Human Gene Knockout Kit (CRISPR)
KN406536

USD 1,290.00

2 Weeks

P2RX6 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN406536 is the updated version of KN206536.
P2rx6 Mouse Gene Knockout Kit (CRISPR)
KN512713

USD 1,290.00

2 Weeks

P2rx6 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN512713 is the updated version of KN312713.
P2rx6 (NM_001159561) Mouse Tagged ORF Clone
MG219240

USD 330.00

3 Weeks

P2rx6 (GFP-tagged) - Mouse purinergic receptor P2X ligand-gated ion channel 6 (P2rx6) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
P2rx6 (NM_011028) Mouse Tagged ORF Clone
MG224683

USD 330.00

3 Weeks

P2rx6 (GFP-tagged) - Mouse purinergic receptor P2X ligand-gated ion channel 6 (P2rx6) transcript variant 1, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
P2rx6 (NM_001159561) Mouse Tagged ORF Clone
MR219240L3

USD 500.00

3 Weeks

Lenti ORF clone of P2rx6 (Myc-DDK-tagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx6 (NM_001159561) Mouse Tagged ORF Clone Lentiviral Particle
MR219240L3V

USD 700.00

6 Weeks

Lenti ORF particles, P2rx6 (Myc-DDK-tagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx6 (NM_001159561) Mouse Tagged ORF Clone
MR219240L4

USD 500.00

3 Weeks

Lenti ORF clone of P2rx6 (mGFP-tagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx6 (NM_001159561) Mouse Tagged ORF Clone Lentiviral Particle
MR219240L4V

USD 700.00

6 Weeks

Lenti ORF particles, P2rx6 (GFP-tagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx6 (NM_011028) Mouse Tagged ORF Clone
MR224683L3

USD 500.00

3 Weeks

Lenti ORF clone of P2rx6 (Myc-DDK-tagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx6 (NM_011028) Mouse Tagged ORF Clone Lentiviral Particle
MR224683L3V

USD 700.00

6 Weeks

Lenti ORF particles, P2rx6 (Myc-DDK-tagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx6 (NM_011028) Mouse Tagged ORF Clone
MR224683L4

USD 500.00

3 Weeks

Lenti ORF clone of P2rx6 (mGFP-tagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx6 (NM_011028) Mouse Tagged ORF Clone Lentiviral Particle
MR224683L4V

USD 700.00

6 Weeks

Lenti ORF particles, P2rx6 (GFP-tagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2X6 (P2RX6) (NM_005446) Human Tagged ORF Clone
RC206536L3

USD 620.00

3 Weeks

Lenti ORF clone of Human purinergic receptor P2X, ligand-gated ion channel, 6 (P2RX6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2X6 (P2RX6) (NM_005446) Human Tagged ORF Clone Lentiviral Particle
RC206536L3V

USD 820.00

6 Weeks

Lenti ORF particles, P2RX6 (Myc-DDK tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 6 (P2RX6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2X6 (P2RX6) (NM_005446) Human Tagged ORF Clone
RC206536L4

USD 620.00

3 Weeks

Lenti ORF clone of Human purinergic receptor P2X, ligand-gated ion channel, 6 (P2RX6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2X6 (P2RX6) (NM_005446) Human Tagged ORF Clone Lentiviral Particle
RC206536L4V

USD 820.00

6 Weeks

Lenti ORF particles, P2RX6 (mGFP-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 6 (P2RX6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2X6 (P2RX6) (NM_001159554) Human Tagged ORF Clone
RC228328L3

USD 620.00

3 Weeks

Lenti-ORF clone of P2RX6 (Myc-DDK-tagged)-Human purinergic receptor P2X, ligand-gated ion channel, 6 (P2RX6), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2X6 (P2RX6) (NM_001159554) Human Tagged ORF Clone Lentiviral Particle
RC228328L3V

USD 820.00

6 Weeks

Lenti ORF particles, P2RX6 (Myc-DDK-tagged)-Human purinergic receptor P2X, ligand-gated ion channel, 6 (P2RX6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2X6 (P2RX6) (NM_001159554) Human Tagged ORF Clone
RC228328L4

USD 620.00

3 Weeks

Lenti-ORF clone of P2RX6 (mGFP-tagged)-Human purinergic receptor P2X, ligand-gated ion channel, 6 (P2RX6), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2X6 (P2RX6) (NM_001159554) Human Tagged ORF Clone Lentiviral Particle
RC228328L4V

USD 820.00

6 Weeks

Lenti ORF particles, P2RX6 (mGFP-tagged)-Human purinergic receptor P2X, ligand-gated ion channel, 6 (P2RX6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2X6 (P2RX6) (NM_001159554) Human Tagged ORF Clone
RG228328

USD 460.00

3 Weeks

P2RX6 (GFP-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 6 (P2RX6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
P2rx6 (NM_012721) Rat Tagged ORF Clone
RR202223

USD 420.00

4 Weeks

P2rx6 (Myc-DDK-tagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2rx6 (NM_012721) Rat Tagged ORF Clone
RR202223L3

USD 640.00

8 Weeks

Lenti ORF clone of P2rx6 (Myc-DDK-tagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx6 (NM_012721) Rat Tagged ORF Clone Lentiviral Particle
RR202223L3V

USD 850.00

12 Weeks

Lenti ORF particles, P2rx6 (Myc-DDK-tagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx6 (NM_012721) Rat Tagged ORF Clone
RR202223L4

USD 700.00

8 Weeks

Lenti ORF clone of P2rx6 (mGFP-tagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2rx6 (NM_012721) Rat Tagged ORF Clone Lentiviral Particle
RR202223L4V

USD 960.00

12 Weeks

Lenti ORF particles, P2rx6 (GFP-tagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2X6 (P2RX6) (NM_005446) Human Untagged Clone
SC317723

USD 740.00

In Stock

P2RX6 (untagged)-Human purinergic receptor P2X, ligand-gated ion channel, 6 (P2RX6), transcript variant 1

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
SC317723 is the updated version of SC123978.
P2X6 (P2RX6) (NM_005446) Human Over-expression Lysate
LC401674

USD 187.00

In Stock

P2RX6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
P2X6 (P2RX6) (NM_001159554) Human Over-expression Lysate
LC431356

USD 121.00

In Stock

P2RX6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
P2X6 (P2RX6) (NM_001159554) Human Over-expression Lysate
LY431356

USD 396.00

In Stock

Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 6 (P2RX6), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

P2rx6 Rabbit Polyclonal Antibody
TA329001

USD 585.00

3 Weeks

Rabbit polyclonal Anti-P2X6 Receptor

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RTKYEEARAPKATTNSA, corresponding to amino acid residues 363-379 of rat P2X6 Receptor?. Intracellular, C-terminus.
P2X6 (P2RX6) Rabbit Polyclonal Antibody
TA338553

USD 375.00

5 Days

Rabbit Polyclonal Anti-P2RXL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RXL1 antibody: synthetic peptide directed towards the N terminal of human P2RXL1. Synthetic peptide located within the following region: NWRVGALQRLLQFGIVVYVVGWALLAKKGYQERDLEPQFSIITKLKGVSV
P2X6 (P2RX6) Rabbit Polyclonal Antibody
TA338554

USD 375.00

5 Days

Rabbit Polyclonal Anti-P2RXL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RXL1 antibody: synthetic peptide directed towards the N terminal of human P2RXL1. Synthetic peptide located within the following region: ERDLEPQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTN
Human P2X6 (P2RX6) activation kit by CRISPRa
GA106080

USD 1,290.00

2 Weeks

P2RX6 CRISPRa kit - CRISPR gene activation of human purinergic receptor P2X 6

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse P2rx6 activation kit by CRISPRa
GA203079

USD 1,290.00

2 Weeks

P2rx6 CRISPRa kit - CRISPR gene activation of mouse purinergic receptor P2X, ligand-gated ion channel, 6

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
P2RX6 Human qPCR Template Standard (NM_005446)
HK209698

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene P2RX6

Application Plasmid of exact quantity for transcript copy number calculation
P2X6 (P2RX6) Human qPCR Primer Pair (NM_005446)
HP208578

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene P2RX6

P2X6 (P2RX6) (NM_005446) Human Over-expression Lysate
LY401674

USD 605.00

5 Days

Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 6 (P2RX6), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

P2rx6 (NM_011028) Mouse Untagged Clone
MC209135

USD 420.00

3 Weeks

P2rx6 (untagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), transcript variant 1, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
P2rx6 (NM_001159561) Mouse Untagged Clone
MC209136

USD 420.00

3 Weeks

P2rx6 (untagged) - Mouse purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), transcript variant 2, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
P2rx6 Mouse qPCR Primer Pair (NM_011028)
MP212226

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene P2rx6

P2rx6 (NM_012721) Rat Untagged Clone
RN202223

USD 420.00

4 Weeks

P2rx6 (untagged ORF) - Rat purinergic receptor P2X, ligand-gated ion channel, 6 (P2rx6), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
P2X6 (P2RX6) (NM_005446) Human 3' UTR Clone
SC214526

USD 560.00

4 Weeks

3`UTR clone of purinergic receptor P2X ligand-gated ion channel 6 (P2RX6) transcript variant 1 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
P2X6 (P2RX6) (NM_001159554) Human 3' UTR Clone
SC214527

USD 560.00

4 Weeks

3`UTR clone of purinergic receptor P2X ligand-gated ion channel 6 (P2RX6) transcript variant 2 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
P2X6 (P2RX6) (NM_005446) Human Untagged Clone
SC317724

USD 740.00

3 Weeks

P2RX6 (untagged)-Human purinergic receptor P2X, ligand-gated ion channel, 6 (P2RX6), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin