Products

cDNA Clones (45)
Proteins (32)
Antibodies (15)
RNAi (12)
Gene Expression (8)
Jump to Filters
View as table Download
PAX8 (NM_003466) Human Tagged ORF Clone
RC200651

USD 98.00

USD 560.00

In Stock

PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8A

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAX8 (NM_013952) Human Tagged ORF Clone
RC214129

USD 420.00

In Stock

PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAX8 (NM_013953) Human Tagged ORF Clone
RC214188

USD 420.00

In Stock

PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8D

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAX8 (NM_013992) Human Tagged ORF Clone
RC215690

USD 420.00

In Stock

PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8E

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAX8 (NM_003466) Human Recombinant Protein
TP300651

USD 823.00

4 Weeks

Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8A

Tag C-Myc/DDK
Expression Host HEK293T
Pax8 (NM_011040) Mouse Tagged ORF Clone
MR207296

USD 430.00

In Stock

Pax8 (Myc-DDK-tagged) - Mouse paired box gene 8 (Pax8)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX8 (NM_003466) Human Tagged ORF Clone Lentiviral Particle
RC200651L1V

USD 820.00

3 Weeks

Lenti ORF particles, PAX8 (Myc-DDK tagged) - Human paired box 8 (PAX8), transcript variant PAX8A, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PAX8 (NM_003466) Human Tagged ORF Clone Lentiviral Particle
RC200651L2V

USD 820.00

6 Weeks

Lenti ORF particles, PAX8 (mGFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8A, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PAX8 (NM_003466) Human Tagged ORF Clone
RG200651

USD 460.00

In Stock

PAX8 (GFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8A

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX8 (NM_003466) Human Tagged ORF Clone
RC200651L4

USD 620.00

In Stock

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8A, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 Human Gene Knockout Kit (CRISPR)
KN400651

USD 1,290.00

2 Weeks

PAX8 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN400651 is the updated version of KN200651.
Pax8 Mouse Gene Knockout Kit (CRISPR)
KN512850

USD 1,290.00

2 Weeks

Pax8 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN512850 is the updated version of KN312850.
Pax8 (NM_011040) Mouse Tagged ORF Clone
MG207296

USD 470.00

3 Weeks

Pax8 (GFP-tagged) - Mouse paired box gene 8 (Pax8)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pax8 (NM_011040) Mouse Tagged ORF Clone
MR207296L3

USD 630.00

3 Weeks

Lenti ORF clone of Pax8 (Myc-DDK-tagged) - Mouse paired box gene 8 (Pax8)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pax8 (NM_011040) Mouse Tagged ORF Clone
MR207296L4

USD 630.00

3 Weeks

Lenti ORF clone of Pax8 (mGFP-tagged) - Mouse paired box gene 8 (Pax8)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_003466) Human Tagged ORF Clone Lentiviral Particle
RC200651L3V

USD 820.00

5 Weeks

Lenti ORF particles, PAX8 (Myc-DDK tagged) - Human paired box 8 (PAX8), transcript variant PAX8A, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_003466) Human Tagged ORF Clone Lentiviral Particle
RC200651L4V

USD 820.00

3 Weeks

Lenti ORF particles, PAX8 (mGFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8A, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013952) Human Tagged ORF Clone
RC214129L3

USD 620.00

3 Weeks

Lenti-ORF clone of PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013952) Human Tagged ORF Clone Lentiviral Particle
RC214129L3V

USD 820.00

6 Weeks

Lenti ORF particles, PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013952) Human Tagged ORF Clone
RC214129L4

USD 620.00

3 Weeks

Lenti-ORF clone of PAX8 (mGFP-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013952) Human Tagged ORF Clone Lentiviral Particle
RC214129L4V

USD 820.00

6 Weeks

Lenti ORF particles, PAX8 (mGFP-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013953) Human Tagged ORF Clone
RC214188L3

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8D, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013953) Human Tagged ORF Clone Lentiviral Particle
RC214188L3V

USD 820.00

6 Weeks

Lenti ORF particles, PAX8 (Myc-DDK tagged) - Human paired box 8 (PAX8), transcript variant PAX8D, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013953) Human Tagged ORF Clone
RC214188L4

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8D, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013953) Human Tagged ORF Clone Lentiviral Particle
RC214188L4V

USD 820.00

6 Weeks

Lenti ORF particles, PAX8 (mGFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8D, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013992) Human Tagged ORF Clone
RC215690L3

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8E, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013992) Human Tagged ORF Clone Lentiviral Particle
RC215690L3V

USD 820.00

6 Weeks

Lenti ORF particles, PAX8 (Myc-DDK tagged) - Human paired box 8 (PAX8), transcript variant PAX8E, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013992) Human Tagged ORF Clone
RC215690L4

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8E, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013992) Human Tagged ORF Clone Lentiviral Particle
RC215690L4V

USD 820.00

6 Weeks

Lenti ORF particles, PAX8 (mGFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8E, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013952) Human Tagged ORF Clone
RG214129

USD 460.00

3 Weeks

PAX8 (GFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8C

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX8 (NM_013953) Human Tagged ORF Clone
RG214188

USD 460.00

3 Weeks

PAX8 (GFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8D

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX8 (NM_013992) Human Tagged ORF Clone
RG215690

USD 460.00

3 Weeks

PAX8 (GFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8E

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pax8 (NM_031141) Rat Tagged ORF Clone
RR206306

USD 630.00

4 Weeks

Pax8 (Myc-DDK-tagged ORF) - Rat paired box 8 (Pax8), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pax8 (NM_031141) Rat Tagged ORF Clone
RR206306L3

USD 820.00

8 Weeks

Lenti ORF clone of Pax8 (Myc-DDK-tagged ORF) - Rat paired box 8 (Pax8), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pax8 (NM_031141) Rat Tagged ORF Clone
RR206306L4

USD 900.00

8 Weeks

Lenti ORF clone of Pax8 (mGFP-tagged ORF) - Rat paired box 8 (Pax8), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pax8 (NM_031141) Rat Tagged ORF Clone Lentiviral Particle
RR206306L4V

USD 1,150.00

12 Weeks

Lenti ORF particles, Pax8 (GFP-tagged ORF) - Rat paired box 8 (Pax8), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_003466) Human Untagged Clone
SC122658

USD 310.00

In Stock

PAX8 (untagged)-Human paired box 8 (PAX8), transcript variant PAX8A

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PAX8 (NM_003466) Human Tagged ORF Clone
RC200651L1

USD 768.00

In Stock

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8A, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Pax8 (NM_011040) Mouse Untagged Clone
MC205740

USD 210.00

In Stock

Pax8 (untagged) - Mouse paired box gene 8 (Pax8), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
PAX8 Rabbit Polyclonal Antibody
TA308698

USD 415.00

5 Days

Rabbit polyclonal antibody to PAX8CC (paired box 8)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 204 of PAX8
PAX8 Rabbit Polyclonal Antibody
TA321580

USD 345.00

In Stock

Anti-PAX8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human paired box 8
PAX8 Rabbit Polyclonal Antibody
TA346519

USD 475.00

5 Days

Rabbit Polyclonal Anti-PAX8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PAX8 antibody is: synthetic peptide directed towards the middle region of Human PAX8. Synthetic peptide located within the following region: YSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFS
PAX8 Rabbit Polyclonal Antibody
TA346520

USD 475.00

5 Days

Rabbit Polyclonal Anti-PAX8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX8 antibody: synthetic peptide directed towards the N terminal of human PAX8. Synthetic peptide located within the following region: KSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDD
PAX8 Human shRNA Plasmid Kit (Locus ID 7849)
TL310595

USD 815.00

In Stock

PAX8 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
PAX8 (NM_003466) Human Tagged ORF Clone
RC200651L2

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8A, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®