Germany
Japan
United Kingdom
China
USD 98.00
USD 390.00
In Stock
POLE3 (Myc-DDK-tagged)-Human polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Pole3 (Myc-DDK-tagged) - Mouse polymerase (DNA directed), epsilon 3 (p17 subunit) (Pole3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLE3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN400874 is the updated version of KN200874.
Pole3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513581 is the updated version of KN313581.
Pole3 (GFP-tagged) - Mouse polymerase (DNA directed), epsilon 3 (p17 subunit) (Pole3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pole3 (Myc-DDK-tagged) - Mouse polymerase (DNA directed), epsilon 3 (p17 subunit) (Pole3)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pole3 (Myc-DDK-tagged) - Mouse polymerase (DNA directed), epsilon 3 (p17 subunit) (Pole3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pole3 (mGFP-tagged) - Mouse polymerase (DNA directed), epsilon 3 (p17 subunit) (Pole3)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pole3 (GFP-tagged) - Mouse polymerase (DNA directed), epsilon 3 (p17 subunit) (Pole3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, POLE3 (Myc-DDK tagged) - Human polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, POLE3 (mGFP-tagged) - Human polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
POLE3 (myc-DDK-tagged) - Human polymerase (DNA directed), epsilon 3, accessory subunit (POLE3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLE3 (GFP-tagged) - Human polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Pole3 (Myc-DDK-tagged ORF) - Rat polymerase (DNA directed), epsilon 3 (p17 subunit) (Pole3), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pole3 (Myc-DDK-tagged ORF) - Rat polymerase (DNA directed), epsilon 3 (p17 subunit) (Pole3), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pole3 (Myc-DDK-tagged ORF) - Rat polymerase (DNA directed), epsilon 3 (p17 subunit) (Pole3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pole3 (mGFP-tagged ORF) - Rat polymerase (DNA directed), epsilon 3 (p17 subunit) (Pole3), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pole3 (GFP-tagged ORF) - Rat polymerase (DNA directed), epsilon 3 (p17 subunit) (Pole3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-POLE3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLE3 antibody: synthetic peptide directed towards the N terminal of human POLE3. Synthetic peptide located within the following region: AERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSC |
POLE3 (untagged)-Human polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 121.00
In Stock
POLE3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 396.00
In Stock
Transient overexpression lysate of polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Pole3 (untagged) - Mouse polymerase (DNA directed), epsilon 3 (p17 subunit) (Pole3), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal POLE3 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This POLE3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 5-34 amino acids from the N-terminal region of human POLE3. |
USD 424.00
5 Days
Rabbit Polyclonal Anti-POLE3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-POLE3 Antibody: synthetic peptide directed towards the N terminal of human POLE3. Synthetic peptide located within the following region: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATS |
POLE3 (1-147, His-tag) human protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
POLE3 (1-147, His-tag) human protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
POLE3 CRISPRa kit - CRISPR gene activation of human DNA polymerase epsilon 3, accessory subunit
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene POLE3
qPCR primer pairs and template standards against Mus musculus gene Pole3
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Pole3
AAV ORF Particles, serotype AAV-2, Pole3 (Myc-DDK-tagged) - Mouse polymerase (DNA directed), epsilon 3 (p17 subunit) (Pole3), 250ul, >10^13 TU/mL
- AAV ORF®
-
POLE3 MS Standard C13 and N15-labeled recombinant protein (NP_059139)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
POLE3 (GFP-tagged) - Human polymerase (DNA directed), epsilon 3, accessory subunit (POLE3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Pole3 (untagged ORF) - Rat polymerase (DNA directed), epsilon 3 (p17 subunit) (Pole3), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of polymerase (DNA directed) epsilon 3 (p17 subunit) (POLE3) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
POLE3 (untagged) - Human polymerase (DNA directed), epsilon 3, accessory subunit (POLE3), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Pole3 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Pole3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
POLE3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human POLE3 (NP_059139.3). |
| Modifications | Unmodified |
Transient overexpression of POLE3 (NM_017443) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of POLE3 (NM_001278255) in HEK293T cells paraffin embedded controls for ICC/IHC staining
POLE3 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
USD 1,395.00
5 Weeks
POLE3 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Pole3 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- POLE3