Germany
Japan
United Kingdom
China
POLK (Myc-DDK-tagged)-Human polymerase (DNA directed) kappa (POLK)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Polk (Myc-DDK-tagged) - Mouse polymerase (DNA directed), kappa (cDNA clone MGC:60610 IMAGE:30057338)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, POLK (Myc-DDK tagged) - Human polymerase (DNA directed) kappa (POLK), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, POLK (mGFP-tagged) - Human polymerase (DNA directed) kappa (POLK), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Polk (Myc-DDK-tagged) - Mouse polymerase (DNA directed), kappa (Polk)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLK - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN419806 is the updated version of KN219806.
Polk - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513587 is the updated version of KN313587.
Polk (GFP-tagged) - Mouse polymerase (DNA directed), kappa (cDNA clone MGC:60610 IMAGE:30057338)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Polk (GFP-tagged) - Mouse polymerase (DNA directed) kappa (Polk), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Polk (Myc-DDK-tagged) - Mouse polymerase (DNA directed), kappa (cDNA clone MGC:60610 IMAGE:30057338)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Polk (Myc-DDK-tagged) - Mouse polymerase (DNA directed), kappa (cDNA clone MGC:60610 IMAGE:30057338), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Polk (mGFP-tagged) - Mouse polymerase (DNA directed), kappa (cDNA clone MGC:60610 IMAGE:30057338)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Polk (GFP-tagged) - Mouse polymerase (DNA directed), kappa (cDNA clone MGC:60610 IMAGE:30057338), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Polk (Myc-DDK-tagged) - Mouse polymerase (DNA directed), kappa (Polk)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Polk (Myc-DDK-tagged) - Mouse polymerase (DNA directed), kappa (Polk), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Polk (mGFP-tagged) - Mouse polymerase (DNA directed), kappa (Polk)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Polk (GFP-tagged) - Mouse polymerase (DNA directed), kappa (Polk), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human polymerase (DNA directed) kappa (POLK), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, POLK (Myc-DDK tagged) - Human polymerase (DNA directed) kappa (POLK), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human polymerase (DNA directed) kappa (POLK), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, POLK (mGFP-tagged) - Human polymerase (DNA directed) kappa (POLK), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
POLK (GFP-tagged) - Human polymerase (DNA directed) kappa (POLK)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Polk (Myc-DDK-tagged ORF) - Rat polymerase (DNA directed) kappa (Polk), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Polk (Myc-DDK-tagged ORF) - Rat polymerase (DNA directed) kappa (Polk), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Polk (Myc-DDK-tagged ORF) - Rat polymerase (DNA directed) kappa (Polk), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Polk (mGFP-tagged ORF) - Rat polymerase (DNA directed) kappa (Polk), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Polk (GFP-tagged ORF) - Rat polymerase (DNA directed) kappa (Polk), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human polymerase (DNA directed) kappa (POLK), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-POLK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLK antibody: synthetic peptide directed towards the N terminal of human POLK. Synthetic peptide located within the following region: KINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQL |
Rabbit Polyclonal Anti-POLK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLK antibody: synthetic peptide directed towards the middle region of human POLK. Synthetic peptide located within the following region: ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ |
Polk (untagged) - Mouse polymerase (DNA directed), kappa (Polk), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human polymerase (DNA directed) kappa (POLK), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
POLK (untagged)-Human polymerase (DNA directed) kappa (POLK)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Polk - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
POLK HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of polymerase (DNA directed) kappa (POLK)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
POLK (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Goat polyclonal anti-POLK antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity-purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 817-830 of Human POLK (polymerase (DNA directed) kappa). |
POLK - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
POLK CRISPRa kit - CRISPR gene activation of human DNA polymerase kappa
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Polk CRISPRa kit - CRISPR gene activation of mouse polymerase (DNA directed), kappa
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene POLK
Polk (untagged) - Mouse polymerase (DNA directed), kappa (cDNA clone MGC:60610 IMAGE:30057338), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Polk
POLK MS Standard C13 and N15-labeled recombinant protein (NP_057302)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Polk (untagged ORF) - Rat polymerase (DNA directed) kappa (Polk), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of polymerase (DNA directed) kappa (POLK) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Polk (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Polk (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Active filters
Target Symbol
- POLK