Germany
Japan
United Kingdom
China
PPP1R13B (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 13B (PPP1R13B)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 1,000.00
3 Weeks
Lenti ORF particles, PPP1R13B (Myc-DDK tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 13B (PPP1R13B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 1,000.00
6 Weeks
Lenti ORF particles, PPP1R13B (mGFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 13B (PPP1R13B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Ppp1r13b (Myc-DDK-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 13B (Ppp1r13b)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP1R13B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN421172 is the updated version of KN221172.
Ppp1r13b - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513730 is the updated version of KN313730.
Ppp1r13b (GFP-tagged) - Mouse protein phosphatase 1 regulatory (inhibitor) subunit 13B (Ppp1r13b), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ppp1r13b (Myc-DDK-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 13B (Ppp1r13b)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp1r13b (Myc-DDK-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 13B (Ppp1r13b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ppp1r13b (mGFP-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 13B (Ppp1r13b)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp1r13b (GFP-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 13B (Ppp1r13b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 13B (PPP1R13B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,000.00
7 Weeks
Lenti ORF particles, PPP1R13B (Myc-DDK tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 13B (PPP1R13B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 13B (PPP1R13B), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,000.00
7 Weeks
Lenti ORF particles, PPP1R13B (mGFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 13B (PPP1R13B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PPP1R13B (GFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 13B (PPP1R13B)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ppp1r13b (Myc-DDK-tagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 13B (Ppp1r13b), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ppp1r13b (Myc-DDK-tagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 13B (Ppp1r13b), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp1r13b (Myc-DDK-tagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 13B (Ppp1r13b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ppp1r13b (mGFP-tagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 13B (Ppp1r13b), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp1r13b (GFP-tagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 13B (Ppp1r13b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 13B (PPP1R13B), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PPP1R13B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 13B (PPP1R13B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-ASPP1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal sequence of human ASPP1. |
Rabbit Polyclonal Anti-PPP1R13B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1R13B antibody: synthetic peptide directed towards the middle region of human PPP1R13B. Synthetic peptide located within the following region: EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA |
Sheep polyclonal anti-ASPP1 antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ASPP1 |
PPP1R13B CRISPRa kit - CRISPR gene activation of human protein phosphatase 1 regulatory subunit 13B
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene PPP1R13B
Ppp1r13b (untagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 13B (Ppp1r13b), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Ppp1r13b
PPP1R13B MS Standard C13 and N15-labeled recombinant protein (NP_056131)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Ppp1r13b (untagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 13B (Ppp1r13b), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of protein phosphatase 1 regulatory (inhibitor) subunit 13B (PPP1R13B) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
PPP1R13B (untagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 13B (PPP1R13B)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Ppp1r13b (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-ASPP1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 478-491 amino acids of Human Apoptosis-stimulating amino acids of p53 protein 1 |
PPP1R13B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-350 of human PPP1R13B (NP_056131.2). |
| Modifications | Unmodified |
Transient overexpression of PPP1R13B (NM_015316) in HEK293T cells paraffin embedded controls for ICC/IHC staining
PPP1R13B - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
PPP1R13B - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Ppp1r13b - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Ppp1r13b - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Ppp1r13b - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Ppp1r13b - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse protein phosphatase 1, regulatory subunit 13B (Ppp1r13b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
PPP1R13B - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Ppp1r13b - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Ppp1r13b - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Active filters
Target Symbol
- PPP1R13B