Germany
Japan
United Kingdom
China
PPP1R1C (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Ppp1r1c (Myc-DDK-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP1R1C (Myc-DDK tagged) - Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP1R1C (GFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP1R1C - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN405047 is the updated version of KN205047.
Ppp1r1c - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513744 is the updated version of KN313744.
Ppp1r1c (GFP-tagged) - Mouse protein phosphatase 1 regulatory (inhibitor) subunit 1C (Ppp1r1c), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ppp1r1c (Myc-DDK-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp1r1c (Myc-DDK-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ppp1r1c (mGFP-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp1r1c (GFP-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ppp1r1c (myc-DDK-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ppp1r1c (myc-DDK-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PPP1R1C (Myc-DDK tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PPP1R1C (mGFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PPP1R1C (Myc-DDK tagged) - Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP1R1C (GFP-tagged) - Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP1R1C (GFP-tagged) - Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ppp1r1c (Myc-DDK-tagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ppp1r1c (Myc-DDK-tagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp1r1c (Myc-DDK-tagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ppp1r1c (mGFP-tagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp1r1c (GFP-tagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-PPP1R1C antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPP1R1C. |
Rabbit Polyclonal Anti-PPP1R1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPP1R1C Antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1R1C. Synthetic peptide located within the following region: GELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRD |
PPP1R1C CRISPRa kit - CRISPR gene activation of human protein phosphatase 1 regulatory inhibitor subunit 1C
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Ppp1r1c CRISPRa kit - CRISPR gene activation of mouse protein phosphatase 1, regulatory inhibitor subunit 1C
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene PPP1R1C
PPP1R1C HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Ppp1r1c (untagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Ppp1r1c (untagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Ppp1r1c (untagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Ppp1r1c
AAV ORF Particles, serotype AAV-2, Ppp1r1c (Myc-DDK-tagged) - Mouse protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c), 250ul, >10^13 TU/mL
- AAV ORF®
-
PPP1R1C MS Standard C13 and N15-labeled recombinant protein (NP_001074014)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
AAV ORF Particles, serotype AAV-2, PPP1R1C (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), 250ul, >10^13 TU/mL
- AAV ORF®
-
AAV ORF Particles, serotype AAV-2, PPP1R1C (Myc-DDK tagged) - Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), transcript variant 2, 250ul, >10^13 TU/mL
- AAV ORF®
-
Ppp1r1c (untagged ORF) - Rat protein phosphatase 1, regulatory (inhibitor) subunit 1C (Ppp1r1c), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PPP1R1C (untagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PPP1R1C (untagged) - Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
PPP1R1C (untagged) - Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
PPP1R1C (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Ppp1r1c (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Ppp1r1c (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of PPP1R1C (NM_001080545) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP1R1C (NM_001261425) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- PPP1R1C