Germany
Japan
United Kingdom
China
PUS7 (Myc-DDK-tagged)-Human pseudouridylate synthase 7 homolog (S. cerevisiae) (PUS7)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human pseudouridylate synthase 7 homolog (S. cerevisiae) (PUS7)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Pus7 (Myc-DDK-tagged) - Mouse pseudouridylate synthase 7 homolog (S. cerevisiae) (Pus7)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Pus7 (myc-DDK-tagged) - Mouse pseudouridylate synthase 7 homolog (S. cerevisiae) (Pus7), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PUS7 (GFP-tagged) - Human pseudouridylate synthase 7 homolog (S. cerevisiae) (PUS7)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PUS7 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN403902 is the updated version of KN203902.
Pus7 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN514262 is the updated version of KN314262.
Pus7 (GFP-tagged) - Mouse pseudouridylate synthase 7 homolog (S. cerevisiae) (cDNA clone MGC:7703 IMAGE:3497634)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pus7 (Myc-DDK-tagged) - Mouse pseudouridylate synthase 7 homolog (S. cerevisiae) (Pus7)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pus7 (Myc-DDK-tagged) - Mouse pseudouridylate synthase 7 homolog (S. cerevisiae) (Pus7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pus7 (mGFP-tagged) - Mouse pseudouridylate synthase 7 homolog (S. cerevisiae) (Pus7)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pus7 (GFP-tagged) - Mouse pseudouridylate synthase 7 homolog (S. cerevisiae) (Pus7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Pus7 (myc-DDK-tagged) - Mouse pseudouridylate synthase 7 homolog (S. cerevisiae) (Pus7), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human pseudouridylate synthase 7 homolog (S. cerevisiae) (PUS7), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PUS7 (Myc-DDK tagged) - Human pseudouridylate synthase 7 homolog (S. cerevisiae) (PUS7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human pseudouridylate synthase 7 homolog (S. cerevisiae) (PUS7), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PUS7 (mGFP-tagged) - Human pseudouridylate synthase 7 homolog (S. cerevisiae) (PUS7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Pus7 (myc-DDK-tagged) - Rat pseudouridylate synthase 7 (Pus7)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PUS7 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
PUS7 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Pus7 (untagged) - Mouse pseudouridylate synthase 7 homolog (S. cerevisiae) (Pus7), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
(untagged)-Human cDNA FLJ33964 fis, clone CTONG2019029, weakly similar to 39.1 KDA PROTEIN IN SURE-CYSC INTERGENIC REGION
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PUS7 (untagged)-Human pseudouridylate synthase 7 homolog (S. cerevisiae) (PUS7)
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of pseudouridylate synthase 7 homolog (S. cerevisiae) (PUS7)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-PUS7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PUS7 antibody: synthetic peptide directed towards the N terminal of human PUS7. Synthetic peptide located within the following region: FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH |
PUS7 CRISPRa kit - CRISPR gene activation of human pseudouridine synthase 7
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Pus7 CRISPRa kit - CRISPR gene activation of mouse pseudouridylate synthase 7
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PUS7
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene PUS7
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene PUS7
Pus7 (untagged) - Mouse pseudouridylate synthase 7 homolog (S. cerevisiae) (Pus7), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Pus7 (untagged) - Mouse pseudouridylate synthase 7 homolog (S. cerevisiae) (Pus7), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qPCR primer pairs and template standards against Mus musculus gene Pus7
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Pus7
PUS7 MS Standard C13 and N15-labeled recombinant protein (NP_061915)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Pus7 (untagged) - Rat pseudouridylate synthase 7 (Pus7)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of pseudouridylate synthase 7 homolog (S. cerevisiae) (PUS7) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
PUS7 (untagged)-Human pseudouridylate synthase 7 homolog (S. cerevisiae) (PUS7)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Pus7 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
PUS7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 352-661 of human PUS7 (NP_061915.2). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
Active filters
Target Symbol
- PUS7