Germany
Japan
United Kingdom
China
SLC18A2 (Myc-DDK-tagged)-Human solute carrier family 18 (vesicular monoamine), member 2 (SLC18A2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 1,092.00
3 Weeks
Lenti ORF particles, SLC18A2 (Myc-DDK tagged) - Human solute carrier family 18 (vesicular monoamine), member 2 (SLC18A2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
USD 1,092.00
3 Weeks
Lenti ORF particles, SLC18A2 (mGFP-tagged) - Human solute carrier family 18 (vesicular monoamine), member 2 (SLC18A2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
USD 1,092.00
6 Weeks
Lenti ORF particles, SLC18A2 (Myc-DDK tagged) - Human solute carrier family 18 (vesicular monoamine), member 2 (SLC18A2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,092.00
3 Weeks
Lenti ORF particles, SLC18A2 (mGFP-tagged) - Human solute carrier family 18 (vesicular monoamine), member 2 (SLC18A2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Slc18a2 (Myc-DDK-tagged) - Mouse solute carrier family 18 (vesicular monoamine), member 2 (cDNA clone MGC:90556 IMAGE:5705966)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human solute carrier family 18 (vesicular monoamine), member 2 (SLC18A2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
SLC18A2 (GFP-tagged) - Human solute carrier family 18 (vesicular monoamine), member 2 (SLC18A2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Slc18a2 (GFP-tagged) - Mouse solute carrier family 18 (vesicular monoamine) member 2 (Slc18a2), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Slc18a2 (GFP-tagged) - Mouse solute carrier family 18 (vesicular monoamine), member 2 (cDNA clone MGC:90556 IMAGE:5705966)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Slc18a2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN515906 is the updated version of KN315906.
Lenti ORF clone of Slc18a2 (Myc-DDK-tagged) - Mouse solute carrier family 18 (vesicular monoamine), member 2 (cDNA clone MGC:90556 IMAGE:5705966)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Slc18a2 (Myc-DDK-tagged) - Mouse solute carrier family 18 (vesicular monoamine), member 2 (cDNA clone MGC:90556 IMAGE:5705966), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Slc18a2 (mGFP-tagged) - Mouse solute carrier family 18 (vesicular monoamine), member 2 (cDNA clone MGC:90556 IMAGE:5705966)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Slc18a2 (GFP-tagged) - Mouse solute carrier family 18 (vesicular monoamine), member 2 (cDNA clone MGC:90556 IMAGE:5705966), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Slc18a2 (Myc-DDK-tagged) - Mouse solute carrier family 18 (vesicular monoamine), member 2 (Slc18a2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Slc18a2 (Myc-DDK-tagged) - Mouse solute carrier family 18 (vesicular monoamine), member 2 (Slc18a2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Slc18a2 (Myc-DDK-tagged) - Mouse solute carrier family 18 (vesicular monoamine), member 2 (Slc18a2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Slc18a2 (mGFP-tagged) - Mouse solute carrier family 18 (vesicular monoamine), member 2 (Slc18a2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Slc18a2 (GFP-tagged) - Mouse solute carrier family 18 (vesicular monoamine), member 2 (Slc18a2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Slc18a2 (Myc-DDK-tagged ORF) - Rat solute carrier family 18 (vesicular monoamine), member 2 (Slc18a2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Slc18a2 (Myc-DDK-tagged ORF) - Rat solute carrier family 18 (vesicular monoamine), member 2 (Slc18a2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Slc18a2 (Myc-DDK-tagged ORF) - Rat solute carrier family 18 (vesicular monoamine), member 2 (Slc18a2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Slc18a2 (mGFP-tagged ORF) - Rat solute carrier family 18 (vesicular monoamine), member 2 (Slc18a2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Slc18a2 (GFP-tagged ORF) - Rat solute carrier family 18 (vesicular monoamine), member 2 (Slc18a2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SLC18A2 (untagged)-Human solute carrier family 18 (vesicular monoamine), member 2 (SLC18A2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human solute carrier family 18 (vesicular monoamine), member 2 (SLC18A2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Transient overexpression lysate of solute carrier family 18 (vesicular monoamine), member 2 (SLC18A2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Slc18a2 (496-515) rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
qSTAR qPCR primer pairs against Mus musculus gene Slc18a2
SLC18A2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Slc18a2 (untagged) - Mouse solute carrier family 18 (vesicular monoamine), member 2 (Slc18a2), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human solute carrier family 18 (vesicular monoamine), member 2 (SLC18A2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Slc18a2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Rabbit Polyclonal Anti-SLC18A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC18A2 Antibody: synthetic peptide directed towards the N terminal of human SLC18A2. Synthetic peptide located within the following region: NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT |
qSTAR qPCR primer pairs against Homo sapiens gene SLC18A2
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Sheep Anti-Vesicular Monoamine Transporter 2, C-terminus (VMAT2) Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the intracellular C-terminal region conjugated to KLH |
SLC18A2 CRISPRa kit - CRISPR gene activation of human solute carrier family 18 member A2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Slc18a2 CRISPRa kit - CRISPR gene activation of mouse solute carrier family 18 (vesicular monoamine), member 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene SLC18A2
| Application | Plasmid of exact quantity for transcript copy number calculation |
Slc18a2 (untagged) - Mouse solute carrier family 18 (vesicular monoamine), member 2 (cDNA clone MGC:90556 IMAGE:5705966), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SLC18A2 MS Standard C13 and N15-labeled recombinant protein (NP_003045)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Slc18a2 (untagged ORF) - Rat solute carrier family 18 (vesicular monoamine), member 2 (Slc18a2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of solute carrier family 18 (vesicular monoamine) member 2 (SLC18A2) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
SLC18A2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR321817 is the updated version of SR304451.
Slc18a2 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-SLC18A2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 500-514 amino acids of human solute carrier family 18 (vesicular monoamine), member 2 |
Active filters
Target Symbol
- SLC18A2