Products

cDNA Clones (46)
Proteins (18)
RNAi (12)
Antibodies (9)
Gene Expression (5)
Jump to Filters
View as table Download
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone
RC201636

USD 98.00

USD 390.00

In Stock

SRSF1 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SF2 (SRSF1) (NM_001078166) Human Tagged ORF Clone
RC213304

USD 98.00

USD 390.00

In Stock

SRSF1 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SF2 (SRSF1) (NM_006924) Human Recombinant Protein
TP301636

USD 823.00

In Stock

Recombinant protein of human splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Srsf1 (NM_173374) Mouse Tagged ORF Clone
MR203152

USD 420.00

In Stock

Srsf1 (Myc-DDK-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Srsf1 (NM_173374) Mouse Tagged ORF Clone Lentiviral Particle
MR203152L1V

USD 820.00

6 Weeks

Lenti ORF particles, Srsf1 (Myc-DDK-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Srsf1 (NM_173374) Mouse Tagged ORF Clone Lentiviral Particle
MR203152L2V

USD 820.00

3 Weeks

Lenti ORF particles, Srsf1 (GFP-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone Lentiviral Particle
RC201636L1V

USD 820.00

3 Weeks

Lenti ORF particles, SRSF1 (Myc-DDK tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SF2 (SRSF1) (NM_001078166) Human Tagged ORF Clone Lentiviral Particle
RC213304L2V

USD 820.00

6 Weeks

Lenti ORF particles, SRSF1 (mGFP-tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone
RG201636

USD 460.00

In Stock

SRSF1 (GFP-tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Srsf1 (NM_173374) Mouse Tagged ORF Clone
MG203152

USD 460.00

3 Weeks

Srsf1 (GFP-tagged) - Mouse splicing factor, arginine/serine-rich 1 (ASF/SF2) (Sfrs1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Srsf1 (NM_001078167) Mouse Tagged ORF Clone
MG226387

USD 230.00

3 Weeks

Srsf1 (GFP-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Srsf1 (NM_173374) Mouse Tagged ORF Clone
MR203152L3

USD 620.00

3 Weeks

Lenti ORF clone of Srsf1 (Myc-DDK-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Srsf1 (NM_173374) Mouse Tagged ORF Clone Lentiviral Particle
MR203152L3V

USD 820.00

6 Weeks

Lenti ORF particles, Srsf1 (Myc-DDK-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Srsf1 (NM_173374) Mouse Tagged ORF Clone
MR203152L4

USD 620.00

3 Weeks

Lenti ORF clone of Srsf1 (mGFP-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Srsf1 (NM_173374) Mouse Tagged ORF Clone Lentiviral Particle
MR203152L4V

USD 820.00

6 Weeks

Lenti ORF particles, Srsf1 (GFP-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Srsf1 (NM_001078167) Mouse Tagged ORF Clone
MR226387

USD 210.00

3 Weeks

Srsf1 (Myc-DDK-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Srsf1 (NM_001078167) Mouse Tagged ORF Clone
MR226387L3

USD 410.00

3 Weeks

Lenti ORF clone of Srsf1 (Myc-DDK-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Srsf1 (NM_001078167) Mouse Tagged ORF Clone Lentiviral Particle
MR226387L3V

USD 610.00

6 Weeks

Lenti ORF particles, Srsf1 (Myc-DDK-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Srsf1 (NM_001078167) Mouse Tagged ORF Clone
MR226387L4

USD 410.00

3 Weeks

Lenti ORF clone of Srsf1 (mGFP-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Srsf1 (NM_001078167) Mouse Tagged ORF Clone Lentiviral Particle
MR226387L4V

USD 610.00

6 Weeks

Lenti ORF particles, Srsf1 (GFP-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone
RC201636L3

USD 620.00

In Stock

Lenti ORF clone of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone Lentiviral Particle
RC201636L3V

USD 820.00

3 Weeks

Lenti ORF particles, SRSF1 (Myc-DDK tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone
RC201636L4

USD 620.00

3 Weeks

Lenti ORF clone of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone Lentiviral Particle
RC201636L4V

USD 820.00

7 Weeks

Lenti ORF particles, SRSF1 (mGFP-tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_001078166) Human Tagged ORF Clone
RC213304L3

USD 620.00

3 Weeks

Lenti ORF clone of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_001078166) Human Tagged ORF Clone Lentiviral Particle
RC213304L3V

USD 820.00

5 Weeks

Lenti ORF particles, SRSF1 (Myc-DDK tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_001078166) Human Tagged ORF Clone
RC213304L4

USD 620.00

In Stock

Lenti ORF clone of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_001078166) Human Tagged ORF Clone Lentiviral Particle
RC213304L4V

USD 820.00

3 Weeks

Lenti ORF particles, SRSF1 (mGFP-tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_001078166) Human Tagged ORF Clone
RG213304

USD 460.00

3 Weeks

SRSF1 (GFP-tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Srsf1 (NM_001109552) Rat Tagged ORF Clone
RR207824

USD 420.00

4 Weeks

Srsf1 (Myc-DDK-tagged ORF) - Rat splicing factor, arginine/serine-rich 1 (Sfrs1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Srsf1 (NM_001109552) Rat Tagged ORF Clone
RR207824L3

USD 640.00

9 Weeks

Lenti ORF clone of Srsf1 (Myc-DDK-tagged ORF) - Rat splicing factor, arginine/serine-rich 1 (Sfrs1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Srsf1 (NM_001109552) Rat Tagged ORF Clone Lentiviral Particle
RR207824L3V

USD 850.00

13 Weeks

Lenti ORF particles, Srsf1 (Myc-DDK-tagged ORF) - Rat splicing factor, arginine/serine-rich 1 (Sfrs1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Srsf1 (NM_001109552) Rat Tagged ORF Clone
RR207824L4

USD 700.00

9 Weeks

Lenti ORF clone of Srsf1 (mGFP-tagged ORF) - Rat splicing factor, arginine/serine-rich 1 (Sfrs1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Srsf1 (NM_001109552) Rat Tagged ORF Clone Lentiviral Particle
RR207824L4V

USD 960.00

13 Weeks

Lenti ORF particles, Srsf1 (GFP-tagged ORF) - Rat splicing factor, arginine/serine-rich 1 (Sfrs1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_006924) Human Untagged Clone
SC115786

USD 310.00

In Stock

SRSF1 (untagged)-Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SRSF1 Human siRNA Oligo Duplex (Locus ID 6426)
SR304331

USD 430.00

In Stock

SRSF1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Srsf1 (NM_173374) Mouse Tagged Lenti ORF Clone
MR203152L2

USD 768.00

In Stock

Lenti ORF clone of Srsf1 (mGFP-tagged) - Mouse serine/arginine-rich splicing factor 1 (Srsf1), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SF2 (SRSF1) Human shRNA Plasmid Kit (Locus ID 6426)
TL309496

USD 946.00

2 Weeks

SRSF1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol (34 ug/ml)
Mammalian Cell Selection Puromycin
SF2 (SRSF1) Rabbit Polyclonal Antibody
TA327123

USD 275.00

3 Weeks

Rabbit anti-SFRS1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SFRS1
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone
RC201636L1

USD 620.00

In Stock

Lenti ORF clone of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone Lentiviral Particle
RC201636L2V

USD 1,020.00

6 Weeks

Lenti ORF particles, SRSF1 (mGFP-tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SF2 (SRSF1) Rabbit Polyclonal Antibody
TA345990

USD 410.00

5 Days

Rabbit Polyclonal Anti-SFRS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRS1 antibody: synthetic peptide directed towards the middle region of human SFRS1. Synthetic peptide located within the following region: GVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRS
SRSF1 Human shRNA Plasmid Kit (Locus ID 6426)
TR309496

USD 715.00

2 Weeks

SRSF1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin
SF2 (SRSF1) (NM_006924) Human Untagged Clone
SC323930

USD 420.00

In Stock

SRSF1 (untagged)-Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Srsf1 Mouse siRNA Oligo Duplex (Locus ID 110809)
SR406968

USD 430.00

In Stock

Srsf1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
SF2 (SRSF1) Rabbit Polyclonal Antibody
TA345989

USD 475.00

5 Days

Rabbit Polyclonal Anti-SFRS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRS1 antibody: synthetic peptide directed towards the C terminal of human SFRS1. Synthetic peptide located within the following region: EFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR
SF2 (SRSF1) (C-term) Rabbit Polyclonal Antibody
AP17742PU-N

USD 450.00

2 Weeks

SF2 (SRSF1) (C-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 165~194 amino acids from the C-terminal region of Human SFRS1