Germany
Japan
United Kingdom
China
VAMP5 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 5 (myobrevin) (VAMP5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Vamp5 (Myc-DDK-tagged) - Mouse vesicle-associated membrane protein 5 (Vamp5), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
VAMP5 (GFP-tagged) - Human vesicle-associated membrane protein 5 (myobrevin) (VAMP5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human vesicle-associated membrane protein 5 (myobrevin) (VAMP5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Vamp5 (myc-DDK-tagged) - Mouse vesicle-associated membrane protein 5 (Vamp5), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
VAMP5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN404973 is the updated version of KN204973.
Vamp5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN518846 is the updated version of KN318846.
Vamp5 (GFP-tagged) - Mouse vesicle-associated membrane protein 5 (Vamp5) transcript variant 1, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Vamp5 (Myc-DDK-tagged) - Mouse vesicle-associated membrane protein 5 (Vamp5), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Vamp5 (Myc-DDK-tagged) - Mouse vesicle-associated membrane protein 5 (Vamp5), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Vamp5 (mGFP-tagged) - Mouse vesicle-associated membrane protein 5 (Vamp5), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Vamp5 (GFP-tagged) - Mouse vesicle-associated membrane protein 5 (Vamp5), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human vesicle-associated membrane protein 5 (myobrevin) (VAMP5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, VAMP5 (Myc-DDK tagged) - Human vesicle-associated membrane protein 5 (myobrevin) (VAMP5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human vesicle-associated membrane protein 5 (myobrevin) (VAMP5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, VAMP5 (mGFP-tagged) - Human vesicle-associated membrane protein 5 (myobrevin) (VAMP5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Vamp5 (Myc-DDK-tagged ORF) - Rat vesicle-associated membrane protein 5 (Vamp5), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Vamp5 (Myc-DDK-tagged ORF) - Rat vesicle-associated membrane protein 5 (Vamp5), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Vamp5 (Myc-DDK-tagged ORF) - Rat vesicle-associated membrane protein 5 (Vamp5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Vamp5 (mGFP-tagged ORF) - Rat vesicle-associated membrane protein 5 (Vamp5), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Vamp5 (GFP-tagged ORF) - Rat vesicle-associated membrane protein 5 (Vamp5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
VAMP5 (untagged)-Human vesicle-associated membrane protein 5 (myobrevin) (VAMP5)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-VAMP5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VAMP5 antibody: synthetic peptide directed towards the middle region of human VAMP5. Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN |
VAMP-5 / Myobrevin (1-72, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
VAMP-5 / Myobrevin (1-72, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
VAMP5 CRISPRa kit - CRISPR gene activation of human vesicle associated membrane protein 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Vamp5 CRISPRa kit - CRISPR gene activation of mouse vesicle-associated membrane protein 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene VAMP5
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene VAMP5
VAMP5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of vesicle-associated membrane protein 5 (myobrevin) (VAMP5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Vamp5 (untagged) - Mouse vesicle-associated membrane protein 5 (Vamp5), transcript variant 1, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Vamp5 (untagged) - Mouse vesicle-associated membrane protein 5 (Vamp5), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against mus musculus gene Vamp5
AAV ORF Particles, serotype AAV-2, Vamp5 (Myc-DDK-tagged) - Mouse vesicle-associated membrane protein 5 (Vamp5), transcript variant 1, 250ul, >10^13 TU/mL
- AAV ORF®
-
AAV ORF Particles, serotype AAV-2, Vamp5 (myc-DDK-tagged) - Mouse vesicle-associated membrane protein 5 (Vamp5), transcript variant 2, 250ul, >10^13 TU/mL
- AAV ORF®
-
VAMP5 MS Standard C13 and N15-labeled recombinant protein (NP_006625)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
AAV ORF Particles, serotype AAV-2, VAMP5 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 5 (myobrevin) (VAMP5), 250ul, >10^13 TU/mL
- AAV ORF®
-
Vamp5 (untagged ORF) - Rat vesicle-associated membrane protein 5 (Vamp5), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
VAMP5 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR323241 is the updated version of SR307358.
Vamp5 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Vamp5 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-VAMP5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
VAMP5 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
VAMP5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human VAMP5 (NP_006625.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
Active filters
Target Symbol
- VAMP5