Products

cDNA Clones (35)
Proteins (16)
RNAi (12)
Antibodies (10)
Gene Expression (8)
Assay Kits (3)
Jump to Filters
View as table Download
WIF1 (NM_007191) Human Tagged ORF Clone
RC205256

USD 420.00

In Stock

WIF1 (Myc-DDK-tagged)-Human WNT inhibitory factor 1 (WIF1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
WIF1 (NM_007191) Human Untagged Clone
SC115674

USD 310.00

In Stock

WIF1 (untagged)-Human WNT inhibitory factor 1 (WIF1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Wif1 (NM_011915) Mouse Tagged ORF Clone
MR205919

USD 300.00

In Stock

Wif1 (Myc-DDK-tagged) - Mouse Wnt inhibitory factor 1 (Wif1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Wif1 (NM_011915) Mouse Tagged ORF Clone Lentiviral Particle
MR205919L2V

USD 700.00

6 Weeks

Lenti ORF particles, Wif1 (GFP-tagged) - Mouse Wnt inhibitory factor 1 (Wif1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
WIF1 (NM_007191) Human Tagged ORF Clone Lentiviral Particle
RC205256L2V

USD 820.00

6 Weeks

Lenti ORF particles, WIF1 (mGFP-tagged) - Human WNT inhibitory factor 1 (WIF1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
WIF1 (NM_007191) Human Recombinant Protein
TP305256

USD 823.00

In Stock

Recombinant protein of human WNT inhibitory factor 1 (WIF1)

Tag C-Myc/DDK
Expression Host HEK293T
Wif1 (BC004048) Mouse Tagged ORF Clone
MR202510

USD 68.00

USD 310.00

In Stock

Wif1 (Myc-DDK-tagged) - Mouse Wnt inhibitory factor 1 (cDNA clone MGC:7686 IMAGE:3497155)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Wif1 (BC004048) Mouse Tagged ORF Clone
MG202510

USD 300.00

In Stock

Wif1 (GFP-tagged) - Mouse Wnt inhibitory factor 1 (cDNA clone MGC:7686 IMAGE:3497155)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Wif1 (NM_053738) Rat Tagged ORF Clone
RR201224

USD 420.00

In Stock

Wif1 (Myc-DDK-tagged ORF) - Rat Wnt inhibitory factor 1 (Wif1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
WIF1 (NM_007191) Human Tagged ORF Clone
RG205256

USD 460.00

In Stock

WIF1 (GFP-tagged) - Human WNT inhibitory factor 1 (WIF1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
WIF1 Human Gene Knockout Kit (CRISPR)
KN405256

USD 1,290.00

2 Weeks

WIF1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN405256 is the updated version of KN205256.
Wif1 Mouse Gene Knockout Kit (CRISPR)
KN519431

USD 1,290.00

2 Weeks

Wif1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN519431 is the updated version of KN319431.
Wif1 (NM_011915) Mouse Tagged ORF Clone
MG205919

USD 330.00

3 Weeks

Wif1 (GFP-tagged) - Mouse Wnt inhibitory factor 1 (Wif1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Wif1 (BC004048) Mouse Tagged ORF Clone
MR202510L3

USD 500.00

3 Weeks

Lenti ORF clone of Wif1 (Myc-DDK-tagged) - Mouse Wnt inhibitory factor 1 (cDNA clone MGC:7686 IMAGE:3497155)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Wif1 (BC004048) Mouse Tagged ORF Clone Lentiviral Particle
MR202510L3V

USD 700.00

6 Weeks

Lenti ORF particles, Wif1 (Myc-DDK-tagged) - Mouse Wnt inhibitory factor 1 (cDNA clone MGC:7686 IMAGE:3497155), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Wif1 (BC004048) Mouse Tagged ORF Clone
MR202510L4

USD 500.00

3 Weeks

Lenti ORF clone of Wif1 (mGFP-tagged) - Mouse Wnt inhibitory factor 1 (cDNA clone MGC:7686 IMAGE:3497155)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Wif1 (BC004048) Mouse Tagged ORF Clone Lentiviral Particle
MR202510L4V

USD 700.00

6 Weeks

Lenti ORF particles, Wif1 (GFP-tagged) - Mouse Wnt inhibitory factor 1 (cDNA clone MGC:7686 IMAGE:3497155), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Wif1 (NM_011915) Mouse Tagged ORF Clone
MR205919L3

USD 500.00

3 Weeks

Lenti ORF clone of Wif1 (Myc-DDK-tagged) - Mouse Wnt inhibitory factor 1 (Wif1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Wif1 (NM_011915) Mouse Tagged ORF Clone
MR205919L4

USD 500.00

3 Weeks

Lenti ORF clone of Wif1 (mGFP-tagged) - Mouse Wnt inhibitory factor 1 (Wif1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Wif1 (NM_011915) Mouse Tagged ORF Clone Lentiviral Particle
MR205919L4V

USD 700.00

6 Weeks

Lenti ORF particles, Wif1 (GFP-tagged) - Mouse Wnt inhibitory factor 1 (Wif1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
WIF1 (NM_007191) Human Tagged ORF Clone
RC205256L3

USD 620.00

3 Weeks

Lenti ORF clone of Human WNT inhibitory factor 1 (WIF1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
WIF1 (NM_007191) Human Tagged ORF Clone Lentiviral Particle
RC205256L4V

USD 820.00

3 Weeks

Lenti ORF particles, WIF1 (mGFP-tagged) - Human WNT inhibitory factor 1 (WIF1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Wif1 (NM_053738) Rat Tagged ORF Clone
RR201224L3

USD 640.00

4 Weeks

Lenti ORF clone of Wif1 (Myc-DDK-tagged ORF) - Rat Wnt inhibitory factor 1 (Wif1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Wif1 (NM_053738) Rat Tagged ORF Clone Lentiviral Particle
RR201224L3V

USD 850.00

8 Weeks

Lenti ORF particles, Wif1 (Myc-DDK-tagged ORF) - Rat Wnt inhibitory factor 1 (Wif1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Wif1 (NM_053738) Rat Tagged ORF Clone
RR201224L4

USD 700.00

4 Weeks

Lenti ORF clone of Wif1 (mGFP-tagged ORF) - Rat Wnt inhibitory factor 1 (Wif1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Wif1 (NM_053738) Rat Tagged ORF Clone Lentiviral Particle
RR201224L4V

USD 960.00

8 Weeks

Lenti ORF particles, Wif1 (GFP-tagged ORF) - Rat Wnt inhibitory factor 1 (Wif1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
WIF1 (NM_007191) Human Tagged ORF Clone
RC205256L1

USD 768.00

In Stock

Lenti ORF clone of Human WNT inhibitory factor 1 (WIF1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
WIF1 Rabbit Polyclonal Antibody
TA332658

USD 275.00

3 Weeks

Rabbit anti-WIF1 Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WIF1
WIF1 Rabbit Polyclonal Antibody
TA383320

USD 275.00

3 Weeks

WIF1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-220 of human WIF1 (NP_009122.2).
Modifications Unmodified
WIF1 Rabbit Polyclonal Antibody
TA383320S

USD 150.00

3 Weeks

WIF1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-220 of human WIF1 (NP_009122.2).
Modifications Unmodified
WIF1 Rabbit Polyclonal Antibody
TA372040

USD 380.00

4 Weeks

WIF1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human WIF1
Wif1 (NM_011915) Mouse Untagged Clone
MC203777

USD 210.00

In Stock

Wif1 (untagged) - Mouse Wnt inhibitory factor 1 (Wif1), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Wif1 (NM_011915) Mouse Tagged ORF Clone
MR205919L1

USD 500.00

In Stock

Lenti ORF clone of Wif1 (Myc-DDK-tagged) - Mouse Wnt inhibitory factor 1 (Wif1)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
WIF1 Rabbit Polyclonal Antibody
TA302106

USD 512.00

2 Weeks

Rabbit Polyclonal Antibody against WIF1 (N-term)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Zebrafish, Xenopus)
Conjugation Unconjugated
Immunogen This WIF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 51-80 amino acids from the N-terminal region of human WIF1.
Wif1 (NM_011915) Mouse Tagged ORF Clone
MR205919L2

USD 500.00

3 Weeks

Lenti ORF clone of Wif1 (mGFP-tagged) - Mouse Wnt inhibitory factor 1 (Wif1)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
WIF1 (NM_007191) Human Tagged ORF Clone
RC205256L2

USD 620.00

3 Weeks

Lenti ORF clone of Human WNT inhibitory factor 1 (WIF1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Wif1 Mouse shRNA Plasmid (Locus ID 24117)
TL513512

USD 815.00

In Stock

Wif1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
WIF1 Human shRNA Plasmid Kit (Locus ID 11197)
TR308367

USD 715.00

In Stock

WIF1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
WIF1 (NM_007191) Human Over-expression Lysate
LC402102

USD 121.00

In Stock

WIF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
WIF1 Human siRNA Oligo Duplex (Locus ID 11197)
SR307682

USD 430.00

In Stock

WIF1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Wif1 Mouse siRNA Oligo Duplex (Locus ID 24117)
SR405930

USD 430.00

In Stock

Wif1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
WIF1 Rabbit Polyclonal Antibody
TA302107

USD 512.00

5 Days

Rabbit Polyclonal Antibody against WIF1 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This WIF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 347-376 amino acids from the C-terminal region of human WIF1.
WIF1 Rabbit Polyclonal Antibody
TA340160

USD 375.00

5 Days

Rabbit Polyclonal Anti-WIF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WIF1 antibody: synthetic peptide directed towards the N terminal of human WIF1. Synthetic peptide located within the following region: RKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN
WIF1 (NM_007191) Human Recombinant Protein
TP720656

USD 330.00

3 Weeks

Purified recombinant protein of Human WNT inhibitory factor 1 (WIF1)

Tag C-His
Expression Host HEK293