Germany
Japan
United Kingdom
China
XRN1 (Myc-DDK-tagged)-Human 5'-3' exoribonuclease 1 (XRN1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Xrn1 (Myc-DDK-tagged) - Mouse 5'-3' exoribonuclease 1 (Xrn1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
XRN1 (GFP-tagged) - Human 5'-3' exoribonuclease 1 (XRN1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
XRN1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN421062 is the updated version of KN221062.
Xrn1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN519527 is the updated version of KN319527.
Xrn1 (GFP-tagged) - Mouse 5'-3' exoribonuclease 1 (Xrn1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
XRN1 (Myc-DDK-tagged)-Human 5'-3' exoribonuclease 1 (XRN1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
XRN1 (myc-DDK-tagged) - Human 5'-3' exoribonuclease 1 (XRN1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
XRN1 (myc-DDK-tagged) - Human 5'-3' exoribonuclease 1 (XRN1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
XRN1 (GFP-tagged) - Human 5'-3' exoribonuclease 1 (XRN1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
XRN1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-XRN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XRN1 antibody: synthetic peptide directed towards the middle region of human XRN1. Synthetic peptide located within the following region: LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM |
XRN1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human XRN1 |
XRN1 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
XRN1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
XRN1 CRISPRa kit - CRISPR gene activation of human 5'-3' exoribonuclease 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Xrn1 CRISPRa kit - CRISPR gene activation of mouse 5'-3' exoribonuclease 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene XRN1
XRN1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
XRN1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
XRN1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
XRN1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of 5'-3' exoribonuclease 1 (XRN1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Xrn1 (untagged) - Mouse 5'-3' exoribonuclease 1 (Xrn1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Xrn1
XRN1 (GFP-tagged) - Human 5'-3' exoribonuclease 1 (XRN1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
XRN1 (GFP-tagged) - Human 5'-3' exoribonuclease 1 (XRN1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
XRN1 (untagged)-Human 5'-3' exoribonuclease 1 (XRN1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
XRN1 (untagged)-Human 5'-3' exoribonuclease 1 (XRN1), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
(untagged)-Human cDNA FLJ38858 fis, clone MESAN2011627, highly similar to 5'-3' exoribonuclease 1
| Vector | pCMV6 series |
| Tag | Tag Free |
XRN1 (untagged) - Human 5'-3' exoribonuclease 1 (XRN1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
XRN1 (untagged) - Human 5'-3' exoribonuclease 1 (XRN1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Xrn1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of XRN1 (NM_019001) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of XRN1 (NM_001042604) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of XRN1 (NM_001282859) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of XRN1 (NM_001282857) in HEK293T cells paraffin embedded controls for ICC/IHC staining
XRN1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
XRN1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Xrn1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Xrn1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
XRN1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Xrn1 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of XRN1 (NM_019001) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of XRN1 (NM_019001) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of XRN1 (NM_001042604) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of XRN1 (NM_001282859) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of XRN1 (NM_001282857) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- XRN1