Products

cDNA Clones (33)
RNAi (12)
Proteins (10)
Gene Expression (7)
Antibodies (5)
Jump to Filters
View as table Download
Kaiso (ZBTB33) (NM_001184742) Human Tagged ORF Clone
RC230416

USD 420.00

In Stock

ZBTB33 (Myc-DDK-tagged)-Human zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Kaiso (ZBTB33) (NM_006777) Human Tagged ORF Clone
RC207287

USD 420.00

In Stock

ZBTB33 (Myc-DDK-tagged)-Human zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Kaiso (ZBTB33) (NM_006777) Human Tagged ORF Clone Lentiviral Particle
RC207287L2V

USD 820.00

6 Weeks

Lenti ORF particles, ZBTB33 (mGFP-tagged) - Human zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Zbtb33 (NM_020256) Mouse Tagged ORF Clone
MR222263

USD 610.00

In Stock

Zbtb33 (Myc-DDK-tagged) - Mouse zinc finger and BTB domain containing 33 (Zbtb33), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Zbtb33 (NM_001079513) Mouse Tagged ORF Clone
MR230844

USD 610.00

In Stock

Zbtb33 (myc-DDK-tagged) - Mouse zinc finger and BTB domain containing 33 (Zbtb33), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Kaiso (ZBTB33) (NM_001184742) Human Tagged ORF Clone
RC230416L3

USD 620.00

In Stock

Lenti ORF clone of Human zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kaiso (ZBTB33) Human Gene Knockout Kit (CRISPR)
KN407287

USD 1,290.00

2 Weeks

ZBTB33 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN407287 is the updated version of KN207287.
Zbtb33 Mouse Gene Knockout Kit (CRISPR)
KN519606

USD 1,290.00

2 Weeks

Zbtb33 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN519606 is the updated version of KN319606.
Zbtb33 (NM_020256) Mouse Tagged ORF Clone
MG222263

USD 670.00

3 Weeks

Zbtb33 (GFP-tagged) - Mouse zinc finger and BTB domain containing 33 (Zbtb33) transcript variant 1, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Zbtb33 (NM_020256) Mouse Tagged ORF Clone
MR222263L3

USD 810.00

3 Weeks

Lenti ORF clone of Zbtb33 (Myc-DDK-tagged) - Mouse zinc finger and BTB domain containing 33 (Zbtb33), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Zbtb33 (NM_020256) Mouse Tagged ORF Clone Lentiviral Particle
MR222263L3V

USD 1,010.00

6 Weeks

Lenti ORF particles, Zbtb33 (Myc-DDK-tagged) - Mouse zinc finger and BTB domain containing 33 (Zbtb33), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Zbtb33 (NM_020256) Mouse Tagged ORF Clone
MR222263L4

USD 810.00

3 Weeks

Lenti ORF clone of Zbtb33 (mGFP-tagged) - Mouse zinc finger and BTB domain containing 33 (Zbtb33), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Zbtb33 (NM_020256) Mouse Tagged ORF Clone Lentiviral Particle
MR222263L4V

USD 1,010.00

6 Weeks

Lenti ORF particles, Zbtb33 (GFP-tagged) - Mouse zinc finger and BTB domain containing 33 (Zbtb33), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kaiso (ZBTB33) (NM_006777) Human Tagged ORF Clone
RC207287L3

USD 620.00

3 Weeks

Lenti ORF clone of Human zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kaiso (ZBTB33) (NM_006777) Human Tagged ORF Clone Lentiviral Particle
RC207287L3V

USD 820.00

7 Weeks

Lenti ORF particles, ZBTB33 (Myc-DDK tagged) - Human zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kaiso (ZBTB33) (NM_006777) Human Tagged ORF Clone
RC207287L4

USD 620.00

3 Weeks

Lenti ORF clone of Human zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kaiso (ZBTB33) (NM_006777) Human Tagged ORF Clone Lentiviral Particle
RC207287L4V

USD 820.00

7 Weeks

Lenti ORF particles, ZBTB33 (mGFP-tagged) - Human zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kaiso (ZBTB33) (NM_001184742) Human Tagged ORF Clone Lentiviral Particle
RC230416L3V

USD 820.00

3 Weeks

Lenti ORF particles, ZBTB33 (Myc-DDK tagged) - Human zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kaiso (ZBTB33) (NM_001184742) Human Tagged ORF Clone
RC230416L4

USD 620.00

3 Weeks

Lenti ORF clone of Human zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kaiso (ZBTB33) (NM_001184742) Human Tagged ORF Clone Lentiviral Particle
RC230416L4V

USD 820.00

6 Weeks

Lenti ORF particles, ZBTB33 (mGFP-tagged) - Human zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kaiso (ZBTB33) (NM_006777) Human Tagged ORF Clone
RG207287

USD 460.00

3 Weeks

ZBTB33 (GFP-tagged) - Human zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Kaiso (ZBTB33) (NM_001184742) Human Tagged ORF Clone
RG230416

USD 460.00

3 Weeks

ZBTB33 (GFP-tagged) - Human zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Zbtb33 (NM_001109314) Rat Tagged ORF Clone
RR212417

USD 910.00

5 Weeks

Zbtb33 (Myc-DDK-tagged ORF) - Rat zinc finger and BTB domain containing 33 (Zbtb33), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Zbtb33 (NM_001109314) Rat Tagged ORF Clone
RR212417L3

USD 1,100.00

10 Weeks

Lenti ORF clone of Zbtb33 (Myc-DDK-tagged ORF) - Rat zinc finger and BTB domain containing 33 (Zbtb33), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Zbtb33 (NM_001109314) Rat Tagged ORF Clone Lentiviral Particle
RR212417L3V

USD 1,320.00

14 Weeks

Lenti ORF particles, Zbtb33 (Myc-DDK-tagged ORF) - Rat zinc finger and BTB domain containing 33 (Zbtb33), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Zbtb33 (NM_001109314) Rat Tagged ORF Clone
RR212417L4

USD 1,210.00

10 Weeks

Lenti ORF clone of Zbtb33 (mGFP-tagged ORF) - Rat zinc finger and BTB domain containing 33 (Zbtb33), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Zbtb33 (NM_001109314) Rat Tagged ORF Clone Lentiviral Particle
RR212417L4V

USD 1,460.00

14 Weeks

Lenti ORF particles, Zbtb33 (GFP-tagged ORF) - Rat zinc finger and BTB domain containing 33 (Zbtb33), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kaiso (ZBTB33) Rabbit Polyclonal Antibody
TA372824

USD 380.00

4 Weeks

ZBTB33 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ZBTB33
Kaiso (ZBTB33) (NM_006777) Human Untagged Clone
SC126900

USD 310.00

In Stock

ZBTB33 (untagged)-Human zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Kaiso (ZBTB33) Rabbit Polyclonal Antibody
TA343638

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZBTB33 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBTB33 antibody: synthetic peptide directed towards the N terminal of human ZBTB33. Synthetic peptide located within the following region: MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNIL
Kaiso (ZBTB33) Human shRNA Plasmid Kit (Locus ID 10009)
TF308309

USD 715.00

In Stock

ZBTB33 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector

Format Retroviral plasmids
Vector pRFP-C-RS
Kaiso (ZBTB33) (NM_006777) Human Tagged ORF Clone
RC207287L2

USD 620.00

3 Weeks

Lenti ORF clone of Human zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Kaiso (ZBTB33) (NM_001184742) Human Over-expression Lysate
LC433416

USD 187.00

In Stock

ZBTB33 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kaiso (ZBTB33) (NM_001184742) Human Over-expression Lysate
LY433416

USD 605.00

In Stock

Transient overexpression lysate of zinc finger and BTB domain containing 33 (ZBTB33), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kaiso (ZBTB33) (NM_006777) Human Over-expression Lysate
LY416422

USD 396.00

5 Days

Transient overexpression lysate of zinc finger and BTB domain containing 33 (ZBTB33)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Human Kaiso (ZBTB33) activation kit by CRISPRa
GA106778

USD 1,290.00

2 Weeks

ZBTB33 CRISPRa kit - CRISPR gene activation of human zinc finger and BTB domain containing 33

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Zbtb33 activation kit by CRISPRa
GA206099

USD 1,290.00

2 Weeks

Zbtb33 CRISPRa kit - CRISPR gene activation of mouse zinc finger and BTB domain containing 33

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
ZBTB33 Human qPCR Template Standard (NM_006777)
HK208040

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene ZBTB33

Application Plasmid of exact quantity for transcript copy number calculation
Kaiso (ZBTB33) Human qPCR Primer Pair (NM_006777)
HP209653

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene ZBTB33

Kaiso (ZBTB33) (NM_006777) Human Over-expression Lysate
LC416422

USD 121.00

2 Weeks

ZBTB33 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Zbtb33 (NM_020256) Mouse Untagged Clone
MC220344

USD 910.00

5 Weeks

Zbtb33 (untagged) - Mouse zinc finger and BTB domain containing 33 (Zbtb33), transcript variant 1, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Zbtb33 (NM_001079513) Mouse Untagged Clone
MC228633

USD 680.00

3 Weeks

Zbtb33 (untagged) - Mouse zinc finger and BTB domain containing 33 (Zbtb33), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Zbtb33 Mouse qPCR Primer Pair (NM_001079513)
MP220116

USD 120.00

5 Days

qSTAR qPCR primer pairs against mus musculus gene Zbtb33

Zbtb33 (NM_001109314) Rat Untagged Clone
RN212417

USD 910.00

6 Weeks

Zbtb33 (untagged ORF) - Rat zinc finger and BTB domain containing 33 (Zbtb33), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Kaiso (ZBTB33) (AK092998) Human Untagged Clone
SC127764

USD 960.00

2 Weeks

(untagged)-Human cDNA FLJ35679 fis, clone SPLEN2019015, moderately similar to Mus musculus zinc finger transcription factor Kaiso mRNA

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Kaiso (ZBTB33) (NM_001184742) Human Untagged Clone
SC329054

USD 1,370.00

3 Weeks

ZBTB33 (untagged)-Human zinc finger and BTB domain containing 33 (ZBTB33) transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Zbtb33 Mouse siRNA Oligo Duplex (Locus ID 56805)
SR418961

USD 430.00

2 Weeks

Zbtb33 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
Zbtb33 Rat siRNA Oligo Duplex (Locus ID 501506)
SR512129

USD 430.00

2 Weeks

Zbtb33 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Kaiso (ZBTB33) Rabbit Polyclonal Antibody
TA383438

USD 220.00

3 Weeks

Kaiso/ZBTB33 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 523-672 of human Kaiso/Kaiso/ZBTB33 (NP_006768.1).
Modifications Unmodified