Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ

Rabbit Polyclonal Anti-HNF1A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA

Rabbit Polyclonal Anti-BTBD14B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BTBD14B antibody: synthetic peptide directed towards the C terminal of human BTBD14B. Synthetic peptide located within the following region: WMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAE

Rabbit Polyclonal Anti-BMP6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the N terminal of human BMP6. Synthetic peptide located within the following region: DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP

Rabbit Polyclonal Anti-SOX7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX7 antibody: synthetic peptide directed towards the middle region of human SOX7. Synthetic peptide located within the following region: LLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLIS

Rabbit Polyclonal Anti-HBZ Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HBZ antibody: synthetic peptide directed towards the N terminal of human HBZ. Synthetic peptide located within the following region: ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA

Rabbit Polyclonal Anti-CEBPB Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CEBPB antibody: synthetic peptide directed towards the N terminal of human CEBPB. Synthetic peptide located within the following region: AIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDL

Rabbit Polyclonal Anti-FOXA1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA1 antibody: synthetic peptide directed towards the N terminal of human FOXA1. Synthetic peptide located within the following region: MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTM

Rabbit Polyclonal Anti-DKK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DKK1 antibody: synthetic peptide directed towards the C terminal of human DKK1. Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

Rabbit Polyclonal Anti-ZNF281 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF281 antibody: synthetic peptide directed towards the middle region of human ZNF281. Synthetic peptide located within the following region: PMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR

Rabbit Polyclonal Anti-JMJD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JMJD6 antibody: synthetic peptide directed towards the N terminal of human JMJD6. Synthetic peptide located within the following region: NHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADA

Rabbit Polyclonal Anti-GNL3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNL3 antibody: synthetic peptide directed towards the middle region of human GNL3. Synthetic peptide located within the following region: RKQEEREDDKDSDQETVDEEVDENSSGMFAAEETGEALSEETTAGEQSTR

Rabbit Polyclonal Anti-GNL3 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GNL3 antibody: synthetic peptide directed towards the N terminal of human GNL3. Synthetic peptide located within the following region: MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR

Rabbit Polyclonal Anti-SHB Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHB antibody: synthetic peptide directed towards the N terminal of human SHB. Synthetic peptide located within the following region: ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY

Rabbit Polyclonal Anti-SHB Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHB antibody: synthetic peptide directed towards the N terminal of human SHB. Synthetic peptide located within the following region: MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSA

Rabbit Polyclonal Anti-BMP6 Antibody - middle region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL

Rabbit Polyclonal Anti-WNT8B Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Wnt8b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Wnt8b. Synthetic peptide located within the following region: SISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRR

Rabbit Polyclonal Anti-EVX1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EVX1 antibody: synthetic peptide directed towards the middle region of human EVX1. Synthetic peptide located within the following region: GSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSASDQMRRYRTAFTR

Rabbit Polyclonal Anti-EVX1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EVX1 antibody: synthetic peptide directed towards the N terminal of human EVX1. Synthetic peptide located within the following region: PEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQ

Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL

Rabbit Polyclonal Anti-NODAL Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NODAL antibody: synthetic peptide directed towards the middle region of human NODAL. Synthetic peptide located within the following region: EFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHH

Rabbit Polyclonal Anti-NODAL Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NODAL antibody: synthetic peptide directed towards the N terminal of human NODAL. Synthetic peptide located within the following region: PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ

Rabbit Polyclonal Anti-PTDSR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTDSR antibody: synthetic peptide directed towards the C terminal of human PTDSR. Synthetic peptide located within the following region: VVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSD

Rabbit Polyclonal Anti-HOXB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXB4 antibody: synthetic peptide directed towards the N terminal of human HOXB4. Synthetic peptide located within the following region: AMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPE

Rabbit Polyclonal Anti-HOXB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXB4 antibody: synthetic peptide directed towards the N terminal of human HOXB4. Synthetic peptide located within the following region: FLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFG

Rabbit Polyclonal Anti-HOXB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXB4 antibody: synthetic peptide directed towards the C terminal of human HOXB4. Synthetic peptide located within the following region: TRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGAAGSA

Rabbit Polyclonal Anti-TCF7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF7 antibody is: synthetic peptide directed towards the N-terminal region of Human TCF7. Synthetic peptide located within the following region: AGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE

Rabbit Polyclonal Anti-ZFP42 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the middle region of human ZFP42. Synthetic peptide located within the following region: FNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHANTNKNEQEG

Rabbit Polyclonal Anti-DLX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLX1 antibody: synthetic peptide directed towards the N terminal of human DLX1. Synthetic peptide located within the following region: MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGH

Rabbit Polyclonal Anti-PPA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPA1 antibody: synthetic peptide directed towards the N terminal of human PPA1. Synthetic peptide located within the following region: PRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT