Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-PPP1R10 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1R10 antibody: synthetic peptide directed towards the N terminal of human PPP1R10. Synthetic peptide located within the following region: SQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKAETRAEEAPEKKREKP

Rabbit Polyclonal Anti-SYNJ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the N terminal of human SYNJ1. Synthetic peptide located within the following region: IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR

Rabbit Polyclonal Anti-ACP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP

Rabbit Polyclonal Anti-CTDSPL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTDSPL antibody: synthetic peptide directed towards the N terminal of human CTDSPL. Synthetic peptide located within the following region: CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC

Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC

Rabbit Polyclonal Anti-PPP2R5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5A antibody: synthetic peptide directed towards the N terminal of human PPP2R5A. Synthetic peptide located within the following region: YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW

Rabbit Polyclonal Anti-SYNJ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the middle region of human SYNJ1. Synthetic peptide located within the following region: PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP

Rabbit Polyclonal Anti-SYNJ2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYNJ2 antibody: synthetic peptide directed towards the N terminal of human SYNJ2. Synthetic peptide located within the following region: SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL

Rabbit Polyclonal Anti-MTMR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTMR1 antibody: synthetic peptide directed towards the C terminal of human MTMR1. Synthetic peptide located within the following region: KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY

Rabbit Polyclonal Anti-EWSR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the N terminal of human EWSR1. Synthetic peptide located within the following region: PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ

Rabbit Polyclonal Anti-PPP4C Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP4C antibody: synthetic peptide directed towards the middle region of human PPP4C. Synthetic peptide located within the following region: TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP

Rabbit Polyclonal Anti-DUSP5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DUSP5 antibody: synthetic peptide directed towards the middle region of human DUSP5. Synthetic peptide located within the following region: ANLHITALLNVSRRTSEACATHLHYKWIPVEDSHTADISSHFQEAIDFID

Rabbit Polyclonal Anti-DUSP5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DUSP5 antibody: synthetic peptide directed towards the middle region of human DUSP5. Synthetic peptide located within the following region: AGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATS

Rabbit Polyclonal Anti-EYA3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EYA3 antibody is: synthetic peptide directed towards the middle region of Human EYA3. Synthetic peptide located within the following region: YQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKN

Rabbit Polyclonal Anti-PPP2R1B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R1B antibody: synthetic peptide directed towards the N terminal of human PPP2R1B. Synthetic peptide located within the following region: EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ

Rabbit Polyclonal Anti-PPP2R1A Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPP2R1A antibody is: synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A. Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL

Rabbit Polyclonal Anti-PPP2R5D Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5D antibody: synthetic peptide directed towards the middle region of human PPP2R5D. Synthetic peptide located within the following region: ETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEA

Rabbit Polyclonal Anti-PPP2R5C Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5C antibody: synthetic peptide directed towards the middle region of human PPP2R5C. Synthetic peptide located within the following region: RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK

Rabbit Polyclonal Anti-PPM1B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPM1B antibody: synthetic peptide directed towards the N terminal of human PPM1B. Synthetic peptide located within the following region: EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN

Rabbit Polyclonal Anti-PPM1A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPM1A antibody: synthetic peptide directed towards the middle region of human PPM1A. Synthetic peptide located within the following region: EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK

Rabbit Polyclonal Anti-MTMR14 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTMR14 antibody: synthetic peptide directed towards the middle region of human MTMR14. Synthetic peptide located within the following region: NFLKHITSEEFSALKTQRRKSLPARDGGFTLEDICMLRRKDRGSTTSLGS

Rabbit Polyclonal Anti-PDP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDP2 antibody: synthetic peptide directed towards the middle region of human PDP2. Synthetic peptide located within the following region: LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLV

Rabbit Polyclonal Anti-PDP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDP2 antibody: synthetic peptide directed towards the middle region of human PDP2. Synthetic peptide located within the following region: CRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMED

Rabbit Polyclonal Anti-PPP2R1A Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the middle region of human PPP2R1A. Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL

Rabbit Polyclonal Anti-PPP2R5E Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5E antibody: synthetic peptide directed towards the N terminal of human PPP2R5E. Synthetic peptide located within the following region: QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK

Rabbit Polyclonal Anti-CYP2A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2A7 antibody: synthetic peptide directed towards the middle region of human CYP2A7. Synthetic peptide located within the following region: KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI

Rabbit Polyclonal Anti-ACPP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACPP antibody: synthetic peptide directed towards the middle region of human ACPP. Synthetic peptide located within the following region: CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV

Rabbit Polyclonal Anti-ACP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the middle region of human ACP1. Synthetic peptide located within the following region: NISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFA

Rabbit Polyclonal Anti-PPP2R3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R3B antibody: synthetic peptide directed towards the C terminal of human PPP2R3B. Synthetic peptide located within the following region: TFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETA

Rabbit Polyclonal Anti-PPP2R3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R3B antibody: synthetic peptide directed towards the C terminal of human PPP2R3B. Synthetic peptide located within the following region: ELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQ

Rabbit Polyclonal Anti-PTP4A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTP4A3 antibody: synthetic peptide directed towards the C terminal of human PTP4A3. Synthetic peptide located within the following region: MKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM