Antibodies for $/€ 289

Download

Rabbit Polyclonal Anti-QTRTD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-QTRTD1 antibody: synthetic peptide directed towards the N terminal of human QTRTD1. Synthetic peptide located within the following region: YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI

Rabbit Polyclonal Anti-Qtrtd1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Qtrtd1 antibody is: synthetic peptide directed towards the C-terminal region of Qtrtd1. Synthetic peptide located within the following region: EVLECIERGVDLFESFFPYQVTERGCALTFTFDCQLNPEETLLQQNGIQE

Rabbit Polyclonal Anti-GTDC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GTDC1 antibody is: synthetic peptide directed towards the N-terminal region of Human GTDC1. Synthetic peptide located within the following region: LIIEAFYGGSHKQLVDLLQEELGDCVVYTLPAKKWHWRARTSALYFSQTI

Rabbit Polyclonal Anti-GTDC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTDC1 antibody: synthetic peptide directed towards the N terminal of human GTDC1. Synthetic peptide located within the following region: CQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPK

Rabbit Polyclonal Anti-SUV39H2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUV39H2 antibody: synthetic peptide directed towards the middle region of human SUV39H2. Synthetic peptide located within the following region: LDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRT

Rabbit Polyclonal Anti-ECHDC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ECHDC3 antibody: synthetic peptide directed towards the N terminal of human ECHDC3. Synthetic peptide located within the following region: SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY

Rabbit Polyclonal Anti-NUDT18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NUDT18 antibody: synthetic peptide directed towards the N terminal of human NUDT18. Synthetic peptide located within the following region: MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVF

Rabbit Polyclonal Anti-NUDT18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NUDT18 antibody: synthetic peptide directed towards the C terminal of human NUDT18. Synthetic peptide located within the following region: KGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKVM

Rabbit Polyclonal Anti-TGS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TGS1 antibody: synthetic peptide directed towards the middle region of human TGS1. Synthetic peptide located within the following region: IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY

Rabbit Polyclonal Anti-DHDDS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHDDS antibody: synthetic peptide directed towards the N terminal of human DHDDS. Synthetic peptide located within the following region: NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR

Rabbit Polyclonal Anti-CXorf34 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXorf34 antibody: synthetic peptide directed towards the N terminal of human CXorf34. Synthetic peptide located within the following region: PPGWSQLFLGTVCKGDFTRVIATKCQKGQKSQKKPSHLGPLDGSWQERLA

Rabbit Polyclonal Anti-CXorf34 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXorf34 antibody: synthetic peptide directed towards the middle region of human CXorf34. Synthetic peptide located within the following region: GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA

Rabbit Polyclonal Anti-NAT13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NAT13 antibody: synthetic peptide directed towards the C terminal of human NAT13. Synthetic peptide located within the following region: AIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN

Rabbit Polyclonal Anti-THUMPD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THUMPD2 antibody: synthetic peptide directed towards the N terminal of human THUMPD2. Synthetic peptide located within the following region: GENEIIAKKLKIEQMQKIEENRDCQLEKQIKEETLEQRDFTTKSEKFQEE

Rabbit Polyclonal Anti-SETD7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SETD7 antibody: synthetic peptide directed towards the C terminal of human SETD7. Synthetic peptide located within the following region: PRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF

Rabbit Polyclonal Anti-B3GNT4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B3GNT4 antibody: synthetic peptide directed towards the N terminal of human B3GNT4. Synthetic peptide located within the following region: MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR

Rabbit Polyclonal Anti-QTRT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-QTRT1 antibody: synthetic peptide directed towards the N terminal of human QTRT1. Synthetic peptide located within the following region: FMPVGTQATMKGITTEQLDALGCRICLGNTYHLGLRPGPELIQKANGLHG

Rabbit Polyclonal Anti-QTRT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-QTRT1 antibody: synthetic peptide directed towards the middle region of human QTRT1. Synthetic peptide located within the following region: KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL

Rabbit Polyclonal Anti-AGXT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGXT2 antibody: synthetic peptide directed towards the N terminal of human AGXT2. Synthetic peptide located within the following region: TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK

Rabbit Polyclonal Anti-SETDB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SETDB2 antibody: synthetic peptide directed towards the N terminal of human SETDB2. Synthetic peptide located within the following region: ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKE

Rabbit Polyclonal Anti-NSUN5C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NSUN5C antibody: synthetic peptide directed towards the middle region of human NSUN5C. Synthetic peptide located within the following region: PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA

Rabbit Polyclonal Anti-PHACS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHACS antibody: synthetic peptide directed towards the middle region of human PHACS. Synthetic peptide located within the following region: RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC

Rabbit Polyclonal Anti-C3orf39 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C3orf39 antibody: synthetic peptide directed towards the N terminal of human C3orf39. Synthetic peptide located within the following region: MHLSAVFNALLVSVLAAVLWKHVRLREHAATLEEELALSRQATEPAPALR

Rabbit Polyclonal Anti-C3orf39 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C3orf39 antibody: synthetic peptide directed towards the middle region of human C3orf39. Synthetic peptide located within the following region: TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN

Rabbit Polyclonal Anti-ALG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALG2 antibody: synthetic peptide directed towards the C terminal of human ALG2. Synthetic peptide located within the following region: QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC

Rabbit Polyclonal Anti-NEK9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEK9 antibody: synthetic peptide directed towards the middle region of human NEK9. Synthetic peptide located within the following region: GGGGGGEEEDSQQESETPDPSGGFRGTMEADRGMEGLISPTEAMGNSNGA

Rabbit Polyclonal Anti-PCMTD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCMTD1 antibody: synthetic peptide directed towards the middle region of human PCMTD1. Synthetic peptide located within the following region: TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIY

Rabbit Polyclonal Anti-TGM7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TGM7 antibody: synthetic peptide directed towards the C terminal of human TGM7. Synthetic peptide located within the following region: TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVE

Rabbit Polyclonal Anti-MATN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MATN1 antibody: synthetic peptide directed towards the middle region of human MATN1. Synthetic peptide located within the following region: KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA

Rabbit Polyclonal Anti-INMT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INMT antibody: synthetic peptide directed towards the N terminal of human INMT. Synthetic peptide located within the following region: KGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGP

Rabbit Polyclonal Anti-LIAS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIAS antibody: synthetic peptide directed towards the N terminal of human LIAS. Synthetic peptide located within the following region: LLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMG

Rabbit Polyclonal Anti-ECHDC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ECHDC2 antibody: synthetic peptide directed towards the middle region of human ECHDC2. Synthetic peptide located within the following region: FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI

Rabbit Polyclonal Anti-TRMT5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRMT5 antibody: synthetic peptide directed towards the middle region of human TRMT5. Synthetic peptide located within the following region: EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT

Rabbit Polyclonal Anti-TRIM32 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the N terminal of human TRIM32. Synthetic peptide located within the following region: MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEK

Rabbit Polyclonal Anti-ILF3 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ILF3 antibody: synthetic peptide directed towards the C terminal of human ILF3. Synthetic peptide located within the following region: SYQGKQGGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNYQYR

Rabbit Polyclonal Anti-JAKMIP1 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JAKMIP1 antibody: synthetic peptide directed towards the middle region of human JAKMIP1. Synthetic peptide located within the following region: FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE

ZNF237 (ZMYM5) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Bovine, Human
Immunogen The immunogen for anti-ZNF237 antibody: synthetic peptide directed towards the N terminal of human ZNF237