Primary Antibodies

View as table Download

Rabbit monoclonal antibody against Dnmt1(clone EPR3521(2))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-BHMT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHMT antibody: synthetic peptide directed towards the N terminal of human BHMT. Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE

Rabbit Polyclonal Anti-LDHB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD

Rabbit Polyclonal Anti-BHMT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHMT antibody: synthetic peptide directed towards the C terminal of human BHMT. Synthetic peptide located within the following region: KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT

Rabbit Polyclonal Anti-GOT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV

Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)

Applications IF, IHC, IP, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520)

Rabbit Monoclonal Antibody against LDHA (Clone EP1563Y)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTAP Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MTAP

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

Rabbit Polyclonal Anti-MAT1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the N terminal of human MAT1A. Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE

Rabbit polyclonal anti-DNMT3B antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human DNMT3B.

DNMT3B (1-50) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from Human DNMT3B (aa 1-50)

Anti-AMD1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 20-33 amino acids of human adenosylmethionine decarboxylase 1

Anti-DNMT1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 637-650 amino acids of Human DNA (cytosine-5)-methyltransferase 1

Rabbit anti-LDHA Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human LDHA

AMD1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of human SAMDC

Rabbit Polyclonal Antibody against DNMT3a

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody was raised against amino acids 10-118 of the human DNMT3a protein.

Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 199 and 406 of BHMT (Uniprot ID#Q93088)

Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 243 of BHMT (Uniprot ID#Q93088)

Rabbit Polyclonal antibody to AHCYL2 (adenosylhomocysteinase-like 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 298 and 578 of AHCYL2 (Uniprot ID#Q96HN2)

Rabbit Polyclonal Anti-CTH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTH antibody: synthetic peptide directed towards the C terminal of human CTH. Synthetic peptide located within the following region: ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK

Rabbit Polyclonal antibody to MTAP (methylthioadenosine phosphorylase)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 283 of MTAP (Uniprot ID#Q13126)

Rabbit anti-GOT1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GOT1

Anti-DNMT3L Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3-like

Anti-DNMT3L Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3-like

Anti-DNMT3A Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha

Anti-DNMT3A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha

Anti-APIP Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-APIP Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-AMD1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 20-33 amino acids of human adenosylmethionine decarboxylase 1

Anti-DNMT1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 637-650 amino acids of Human DNA (cytosine-5)-methyltransferase 1

Anti-AMD1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 298-310 amino acids of human adenosylmethionine decarboxylase 1

Anti-AMD1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 298-310 amino acids of human adenosylmethionine decarboxylase 1

Anti-TAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 250 amino acids of human tyrosine aminotransferase

Rabbit Polyclonal Anti-DNMT3A Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DNMT3A

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CBS

Rabbit Polyclonal Anti-GOT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GOT1

Rabbit Polyclonal Anti-CDO1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CDO1

Rabbit Polyclonal Anti-GOT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GOT2

Rabbit Polyclonal Anti-TRDMT1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRDMT1