Primary Antibodies

View as table Download

Calca rabbit polyclonal antibody

Applications IF, IHC
Reactivities Human, Mammalian, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde.

Rabbit Polyclonal Aggrecan Neoepitope Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Porcine
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112]

Rabbit Polyclonal Antibody against ATG5

Applications IHC, WB
Reactivities Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0]

Rabbit Polyclonal Niemann-Pick C1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Porcine, Hamster, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118]

Rabbit Polyclonal Ki-67/MKI67 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Porcine
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human Ki67 (within residues 1550-1700) [Swiss-Prot# P46013]
TA336650 is a possible alternative to TA336566.

Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker

Applications IHC, WB
Reactivities Human, Mouse, Monkey, Rat, Porcine, Horse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936]

Rabbit Polyclonal MUC-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.

Rabbit Polyclonal Antibody against ADFP

Applications IHC, WB
Reactivities Bovine, Human, Monkey, Mouse, Porcine
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human protein, within residues 150-250. [Swiss-Prot# Q99541]

Rabbit Polyclonal Antibody against LOX

Applications IHC, WB
Reactivities Human, Mouse, Rat, Porcine, Cow
Conjugation Unconjugated
Immunogen A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300

Rabbit Polyclonal Pyruvate Carboxylase Antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Pyruvate Carboxylase protein (within residues 930-1050). [Swiss-Prot P11498]

Rabbit Polyclonal LC3/MAP1LC3A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Porcine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human LC3 protein (within residues 50-120). [Swiss-Prot Q9H492]

PGP9.5 (UCHL1) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Porcine, Rat
Conjugation Unconjugated

Rabbit Polyclonal anti-UBB Antibody

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila
Conjugation Unconjugated
Immunogen Native bovine Ubiquitin, conjugated to KLH

Rabbit Polyclonal LOX propeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Porcine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of mouse LOX propeptide (residues 78-115). [UniProt# P28301]

Rabbit Polyclonal Beclin 1/ATG6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Canine, Porcine, Primate
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457]

Rabbit Polyclonal Fatty Acid Synthase/FASN Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Chicken, Hamster, Porcine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide, conjugated to KLH, made near the N-terminus of mouse FAS. [Swiss-Prot# P19096]

Rabbit Polyclonal beta-Actin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Porcine, Avian, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709].

Rabbit Polyclonal Lgr5/GPR49 Antibody

Applications IHC
Reactivities Human, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human GPR49/LGR5 protein (within residues 650-700). [Swiss-Prot# O75473]

Rabbit Polyclonal TLR5 Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Porcine
Conjugation Unconjugated
Immunogen This antibody was developed against KLH-conjugated synthetic peptide corresponding to a portion of human TLR5 found between amino acids 300-350. It will cross-react with mouse and rat TLR5.

Insulin (INS) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Bovine, Porcine, Rat
Conjugation Unconjugated

G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS

PGP9.5 (UCHL1) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Porcine, Rat
Conjugation Unconjugated

Rabbit Polyclonal anti-CANX Antibody

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus
Conjugation Unconjugated
Immunogen Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues.

Rabbit Polyclonal LRRK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Porcine, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region, within residues 2507–2527 of the human LRRK2 protein, conjugated to KLH. [Swiss-Prot# Q5S007]

Rabbit Polyclonal SLC31A1/CTR1 Antibody

Applications IHC
Reactivities Human, Mouse, Porcine, Rat, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen A synthetic peptide derived from a C-terminal sequence of the human CTR1.

Rabbit Polyclonal PLK1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Porcine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 100-200 of human PLK1 was used as the immunogen.

Rabbit Polyclonal SOX2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Chicken, Feline, Porcine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 100-150 of human SOX2 was used as the immunogen for the antibody.

Rabbit Polyclonal IFRD1 Antibody

Applications IHC, WB
Reactivities Human, Bovine, Canine, Porcine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 70-120 of human Tis7 was used as the immunogen.

BMP4 (20-34) rabbit polyclonal antibody

Applications IHC
Reactivities Bovine, Chicken, Frog, Human, Mouse, Porcine, Rat, Zebrafish
Conjugation Unconjugated