Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal IL-1RAcP Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-1RAcP antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of IL-1RAcP, which differs from the sequence of mouse origin by three amino acids. |
IL1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL1A |
Rabbit Monoclonal Antibody against NGF (Clone EP1318Y)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FASL Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FASL Antibody: A synthesized peptide derived from human FASL |
Rabbit Polyclonal Anti-Interleukin 1β Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 1β Antibody: A synthesized peptide derived from human Interleukin 1β |
Rabbit Polyclonal Anti-NGF beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NGF beta Antibody: A synthesized peptide derived from human NGF beta |
IL1 beta (IL1B) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, FN, WB |
| Reactivities | Chicken |
| Immunogen | Recombinaint Chicken IL-1B |
Rabbit polyclonal anti-IL-3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-3 antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-3 protein. |
FAS Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FAS |
Rabbit anti-NGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human NGF |
Rabbit anti-IL1B Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL1B |
Rabbit Polyclonal Anti-FAS ligand Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAS ligand Antibody: A synthesized peptide derived from human FAS ligand |
TNFRSF1A (20-43) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat |
| Immunogen | TNFRSF1A antibody was raised against a synthetic peptide based on residues 20-43 of Mouse TNF-R1. |
Rabbit Polyclonal IL-1RAcP Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-1RAcP antibody was raised against a 16 amino acid peptide near the carboxy terminus of human IL-1RAcP. The immunogen is located within the last 50 amino acids of IL-1RAcP. |
Rabbit polyclonal TNF Receptor-1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TNF receptor-1. |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit Polyclonal Fas Ligand Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal IL1 alpha Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Fas Ligand (FASLG) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | FASLG antibody was raised against peptide mapping near the amino terminus of rat FAS-L |
Fas Ligand (FASLG) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence mapping at the C-terminal of human FAS-L |
Anti-Human IL-1alpha Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-1alpha |
Rabbit Polyclonal Anti-TNFRSF1A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI |
IL1 beta (IL1B) rabbit polyclonal antibody, Serum
| Applications | WB |
| Reactivities | Human |
| Immunogen | Recombinant human Interleukin-1ß |
IL1 beta (IL1B) rabbit polyclonal antibody, Serum
| Applications | WB |
| Reactivities | Human |
| Immunogen | Recombinant human Interleukin-1ß |
IL1 alpha (IL1A) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the amino acid residues surrounding S87 of human IL1A |
Active filters
Antibody Hosts
- Rabbit
Families
- Secreted Protein
Pathways
- Apoptosis