Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit Polyclonal Anti-LEP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
Flt3 ligand (FLT3LG) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 180-230 of Human Flt3-L. |
IL5RA rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide, corresponding to amino acids 50-100 of Human IL-5Rα. |
Inhibin beta A (INHBA) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | This INHBA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 85-112 amino acids from the N-terminal region of human INHBA. |
Rabbit Polyclonal CCR5 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5. |
Rabbit polyclonal CSFR (Ab-809) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CSFR around the phosphorylation site of tyrosine 809 (S-N-YP-I-V). |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Rabbit anti-EPO Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EPO |
PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human PDGF-AA (Cat.-No PA118). |
Rabbit Polyclonal Antibody against CSF1R
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MCSF Receptor (CSF1R) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 940-971 amino acids from the C-terminal region of human MCSF Receptor (CSF1R). |
Rabbit Polyclonal IL-21 Receptor Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IL-21 receptor antibody was raised against a synthetic peptide corresponding to amino acids 97 to 111 of human IL-21 receptor precursor. The immunogen is located within amino acids 80 - 130 of IL-21 Receptor. |
Rabbit Polyclonal antibody to RANKL (tumor necrosis factor (ligand) superfamily, member 11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 253 and 317 of RANKL (Uniprot ID#O14788) |
Rabbit polyclonal IL-9R (Ser519) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-9R around the phosphorylation site of serine 519 (A-R-SP-W-T). |
| Modifications | Phospho-specific |
Rabbit anti-IFNGR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNGR1 |
Rabbit anti-TNFSF13B Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TNFSF13B |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Antibody was raised against a peptide corresponding to amino acids 2 to 21 of human CX3CR1. The sequence differs from those of mouse and rat CX3CR1 by four amino acids (NP_001328). |
Active filters
Category
- Antibodies
Applications
- IHC
Clonalities
- Polyclonal
Pathways
- Cytokine-cytokine receptor interaction
Filter by
Target Symbol
- EGFR (23)
- KDR (16)
- CXCR4 (12)
- EGF (11)
- PDGFRB (11)
- CSF1R (10)
- CXCL12 (9)
- LEP (8)
- TNF (8)
- PDGFB (7)
- TNFSF13 (7)
- CX3CR1 (6)
- FASLG (6)
- IL6 (6)
- MET (6)
- PDGFA (6)
- TNFRSF1A (6)
- VEGFA (6)
- CCL2 (5)
- CCR3 (5)
- CD70 (5)
- CXCR2 (5)
- CXCR3 (5)
- IL17A (5)
- IL23A (5)
- KIT (5)
- KITLG (5)
- NGFR (5)
- TNFRSF11B (5)
- TSLP (5)
- ACVR1 (4)
- AMH (4)
- CCR1 (4)
- CCR6 (4)
- CCR7 (4)
- CRLF2 (4)
- CSF2 (4)
- EDA (4)
- FLT1 (4)
- FLT3 (4)
- GH1 (4)
- IFNB1 (4)
- IFNG (4)
- IL10 (4)
- IL12A (4)
- IL23R (4)
- IL4 (4)
- INHBA (4)
- LEPR (4)
- TGFB1 (4)
- TGFB3 (4)
- TGFBR2 (4)
- TNFRSF1B (4)
- TNFRSF6B (4)
- ACVR1B (3)
- BMP2 (3)
- BMP7 (3)
- CCL1 (3)
- CCL17 (3)
- CCL20 (3)
- CCL21 (3)
- CCR4 (3)
- CCR5 (3)
- CCR8 (3)
- CD40 (3)
- CSF3R (3)
- CX3CL1 (3)
- CXCL8 (3)
- CXCR5 (3)
- EPOR (3)
- FAS (3)
- IL18R1 (3)
- IL1B (3)
- IL1R1 (3)
- IL2 (3)
- IL20 (3)
- IL2RB (3)
- LTA (3)
- PDGFRA (3)
- PRL (3)
- TGFBR1 (3)
- TNFRSF14 (3)
- TNFSF11 (3)
- TNFSF12 (3)
- BMPR1B (2)
- BMPR2 (2)
- CCL15 (2)
- CCL4 (2)
- CCL5 (2)
- CCL7 (2)
- CCR9 (2)
- CD27 (2)
- CNTF (2)
- CNTFR (2)
- CSF1 (2)
- CSF3 (2)
- CTF1 (2)
- CXCL14 (2)
- CXCL3 (2)
- CXCR6 (2)
Reactivities
Antibody Hosts
Isotypes
Conjugates
Modifications
Families
- Druggable Genome (589)
- Transmembrane (397)
- Secreted Protein (317)
- ES Cell Differentiation/IPS (155)
- Protein Kinase (105)
- GPCR (63)
- Adult stem cells (50)
- Cancer stem cells (30)
- Stem cell relevant signaling - JAK/STAT signaling pathway (25)
- Embryonic stem cells (24)
- Transcription Factors (20)
- Induced pluripotent stem cells (18)
- Stem cell - Pluripotency (7)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (7)
- Protease (2)
- Stem cell relevant signaling - DSL/Notch pathway (2)