Calca rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Calca rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Aggrecan Neoepitope Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Rabbit Polyclonal Antibody against ATG5
Applications | IHC, WB |
Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit Polyclonal Niemann-Pick C1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118] |
Rabbit Polyclonal Ki-67/MKI67 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human Ki67 (within residues 1550-1700) [Swiss-Prot# P46013] |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
Applications | IHC, WB |
Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit Polyclonal MUC-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal Antibody against ADFP
Applications | IHC, WB |
Reactivities | Bovine, Human, Monkey, Mouse, Porcine |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human protein, within residues 150-250. [Swiss-Prot# Q99541] |
Rabbit Polyclonal Antibody against LOX
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine, Cow |
Conjugation | Unconjugated |
Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
Rabbit Polyclonal Pyruvate Carboxylase Antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human Pyruvate Carboxylase protein (within residues 930-1050). [Swiss-Prot P11498] |
Rabbit Polyclonal LC3/MAP1LC3A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region of the human LC3 protein (within residues 50-120). [Swiss-Prot Q9H492] |
PGP9.5 (UCHL1) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-UBB Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila |
Conjugation | Unconjugated |
Immunogen | Native bovine Ubiquitin, conjugated to KLH |
Rabbit Polyclonal LOX propeptide Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of mouse LOX propeptide (residues 78-115). [UniProt# P28301] |
Rabbit Polyclonal Beclin 1/ATG6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Canine, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457] |
Rabbit Polyclonal Fatty Acid Synthase/FASN Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Chicken, Hamster, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide, conjugated to KLH, made near the N-terminus of mouse FAS. [Swiss-Prot# P19096] |
Rabbit Polyclonal beta-Actin Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine, Avian, Hamster |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709]. |
Rabbit Polyclonal Lgr5/GPR49 Antibody
Applications | IHC |
Reactivities | Human, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human GPR49/LGR5 protein (within residues 650-700). [Swiss-Prot# O75473] |
Rabbit Polyclonal TLR5 Antibody
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine |
Conjugation | Unconjugated |
Immunogen | This antibody was developed against KLH-conjugated synthetic peptide corresponding to a portion of human TLR5 found between amino acids 300-350. It will cross-react with mouse and rat TLR5. |
Insulin (INS) rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Bovine, Porcine, Rat |
Conjugation | Unconjugated |
G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS |
PGP9.5 (UCHL1) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-CANX Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
Conjugation | Unconjugated |
Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Rabbit Polyclonal LRRK2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Porcine, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region, within residues 2507–2527 of the human LRRK2 protein, conjugated to KLH. [Swiss-Prot# Q5S007] |
Rabbit Polyclonal SLC31A1/CTR1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Porcine, Rat, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from a C-terminal sequence of the human CTR1. |
Rabbit Polyclonal PLK1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 100-200 of human PLK1 was used as the immunogen. |
Rabbit Polyclonal SOX2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Chicken, Feline, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 100-150 of human SOX2 was used as the immunogen for the antibody. |
Rabbit Polyclonal IFRD1 Antibody
Applications | IHC, WB |
Reactivities | Human, Bovine, Canine, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 70-120 of human Tis7 was used as the immunogen. |
BMP4 (20-34) rabbit polyclonal antibody
Applications | IHC |
Reactivities | Bovine, Chicken, Frog, Human, Mouse, Porcine, Rat, Zebrafish |
Conjugation | Unconjugated |