Primary Antibodies

View as table Download

c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP

Applications ELISA, IHC, WB
Reactivities Human
Conjugation HRP

c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP

Applications ELISA, IHC, WB
Reactivities Human
Conjugation AP

CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CCND1

Cyclin D1 (CCND1) mouse monoclonal antibody, clone CD1.1

Applications ELISA, FC, IF, IHC, IP, WB
Reactivities Human, Rat

c-Myc (MYC) chicken polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Human
Immunogen Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH.
The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%.

c-Myc (MYC) rat monoclonal antibody, clone JAC6, Purified

Applications IF, IHC, IP, WB

c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified

Applications ELISA, FC, IHC, IP, WB
Reactivities Human

c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified

Applications ELISA, FC, IHC, WB
Reactivities Human

c-Myc (MYC) mouse monoclonal antibody, clone IMD-3, Purified

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat

c-Myc (MYC) chicken polyclonal antibody, FITC

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation FITC
Immunogen Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. After repeated injections, immune eggs were collected, from which the IgY fractions were prepared.

c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Immunogen This antibody was purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide.

Anti-CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit polyclonal MYC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Myc.

Rabbit Polyclonal c-Myc Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

Cyclin D1 (CCND1) mouse monoclonal antibody, clone CY-D1, Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

CTBP2 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Cyclin D1 (CCND1) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen CCND1 antibody was raised against kLH conjugated synthetic peptide corresponding to amino acid residues surrounding S90 of human Cyclin D1.

c-Myc (MYC) rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, WB
Conjugation Biotin
Immunogen Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc.

c-Myc (MYC) rabbit polyclonal antibody, HRP

Applications ELISA, IHC, WB
Conjugation HRP
Immunogen Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc.

c-Myc (MYC) mouse monoclonal antibody, clone 9E10, FITC

Applications FC, IF, IHC
Reactivities Human
Conjugation FITC

Rabbit Polyclonal C-myc antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human C-myc

CTBP2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human CTBP2.

Rabbit Polyclonal Antibody against MYC (T58)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 36-65 amino acids from human MYC.

Rabbit Polyclonal Anti-CTBP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the C terminal of human CTBP2. Synthetic peptide located within the following region: TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVA

Rabbit Polyclonal Anti-CTBP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the middle region of human CTBP2. Synthetic peptide located within the following region: APGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNE

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTBP2 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-CCND1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-270 amino acids of Human Cyclin D1

Anti-CTBP2 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human C-terminal binding protein 2

Anti-CTBP2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human C-terminal binding protein 2

Rabbit Polyclonal Anti-CTBP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CTBP2

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

c-Myc mouse monoclonal antibody, clone 1A6, Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

c-Myc mouse monoclonal antibody, clone 1A6, HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CTBP2 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CTBP2 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

CTBP2 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP