Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal PKA CAT (Ab-197) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C). |
ITGA3 / CD49c Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bovine, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA3 / CD49c antibody was raised against synthetic 18 amino acid peptide from N-terminus of human ITGA3 / CD49c. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Bovine (100%); Marmoset, Mouse, Dog, Bat, Hamster, Elephant, Horse, Opossum (94%); Rabbit (89%). |
Anti-SHC1 (Phospho-Tyr427) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 427 (P-S-Y(p)-V-N derived from Human Shc1. |
| Modifications | Phospho-specific |
Rabbit polyclonal CACNG6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6. |
Mouse Monoclonal ITGB3 (CD61) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS |
Rabbit polyclonal Integrin beta3 (Ab-785) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β3 around the phosphorylation site of tyrosine 785 (I-T-YP-R-G). |
Rabbit polyclonal ITGB4 (Tyr1510) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-GNAS antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
Rabbit Polyclonal Anti-CACNB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP |
Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA2 / CD49b antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla, Marmoset, Mouse, Bovine, Elephant, Horse (93%); Rat, Panda, Pig (86%). |
Rabbit Polyclonal Anti-ITGB1 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGB1 / Integrin Beta 1 / CD29 antibody was raised against synthetic 17 amino acid peptide from extracellular domain of human Integrin Beta 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Dog, Bat, Panda, Horse (94%); Sheep, Bovine, Cat, Elephant, Pig (88%). |
Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA2 / CD49b antibody was raised against synthetic 16 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Panda, Pig (100%); Bovine, Elephant, Horse, Chicken, Lizard (94%); Opossum, Turkey (88%); Bat, Hamster, Stickleback (81%). |
Rabbit Polyclonal Anti-ITGB1 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGB1 / Integrin Beta 1 / CD29 antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human Integrin Beta 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Sheep, Dog, Bovine, Cat, Elephant, Panda, Horse, Pig (100%); Platypus (93%); Bat, Opossum (86%). |
Rabbit Polyclonal Anti-CACNA1C Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CACNA1C / Cav1.2 antibody was raised against synthetic 16 amino acid peptide from internal region of human CACNA1C / Cav1.2. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey, Marmoset (94%). |
Rabbit Polyclonal Anti-ITGA6 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA6/Integrin Alpha 6/CD49f antibody was raised against synthetic 18 amino acid peptide from N-terminus of human ITGA6 / CD49f. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse (100%); Platypus (94%); Opossum (89%); Turkey, Chicken (83%). |
Rabbit Polyclonal Anti-ITGA4 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA4 / VLA-4 / CD49d antibody was raised against synthetic 14 amino acid peptide from internal region of human ITGA4 / VLA-4. Percent identity with other species by BLAST analysis: Human (100%), Gorilla (100%), Gibbon (100%), Monkey (100%), Marmoset (100%), Mouse (100%), Rat (100%), Elephant (93%), Panda (93%), Dog (86%), Bat (86%), Bovine (86%), Rabbit (86%), Horse (86%), Pig (86%). |
Carrier-free (BSA/glycerol-free) DES mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (glycerol/BSA-free) TNNC1 mouse monoclonal antibody, clone OTI9D4 (formerly 9D4)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (glycerol/BSA-free) TNNC1 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
Active filters
Reactivities
- Human
Applications
- IHC
Pathways
- Dilated cardiomyopathy
Filter by
Category
Target Symbol
- TNNT2 (38)
- GNAS (32)
- TNNI3 (31)
- DES (27)
- TNNC1 (23)
- TNF (17)
- IGF1 (14)
- SHC1 (14)
- ITGB3 (13)
- TPM2 (7)
- ACTB (6)
- SGCD (5)
- ITGB1 (4)
- LMNA (4)
- TGFB1 (4)
- CACNA1C (3)
- ITGA2 (3)
- ITGA6 (3)
- MYH7 (3)
- TGFB3 (3)
- TPM1 (3)
- ACTC1 (2)
- ADCY1 (2)
- ADCY4 (2)
- ADCY5 (2)
- CACNB1 (2)
- DMD (2)
- EMD (2)
- ITGA2B (2)
- ITGA7 (2)
- ITGB4 (2)
- PRKACA (2)
- PRKACG (2)
- PRKX (2)
- TGFB2 (2)
- ACTG1 (1)
- ADCY3 (1)
- ADCY6 (1)
- ADCY7 (1)
- ADCY8 (1)
- ADRB1 (1)
- ATP2A2 (1)
- CACNA1D (1)
- CACNA1S (1)
- CACNB2 (1)
- CACNG6 (1)
- ITGA11 (1)
- ITGA3 (1)
- ITGA4 (1)
- ITGAV (1)
- ITGB5 (1)
- ITGB6 (1)
- ITGB7 (1)
- LAMA2 (1)
- MYBPC3 (1)
- MYL2 (1)
- MYL3 (1)
- PRKACB (1)
- SGCA (1)