Primary Antibodies

View as table Download

Rabbit polyclonal anti-ADCY5/6 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCY5/6.

Rabbit polyclonal CaMK2-beta/gamma/delta (Thr287) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CaMK2-β/?/d around the phosphorylation site of threonine 287 (Q-E-TP-V-E).
Modifications Phospho-specific

Rabbit polyclonal anti-PRKX antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRKX.

CDK1 / CDC2 Mouse Monoclonal (26E11) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal RSK2 (RPS6KA3) Antibody (N-term)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This RSK2 (RPS6KA3) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human RSK2 (RPS6KA3).

Rabbit polyclonal p90 RSK (Ab-573) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p90 RSK around the phosphorylation site of threonine 573 (L-M-TP-P-C).

Rabbit polyclonal p90 RSK (Phospho-Thr573) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human P90RSK around the phosphorylation site of threonine 573 (L-M-TP-P-C).
Modifications Phospho-specific

Rabbit Polyclonal Aurora A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an N-terminal region of the human Aurora A protein (within residues 50-200). [Swiss-Prot O14965]

Rabbit Polyclonal Cyclin E2 Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Antibody against RPS6KA1 (S732)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RPS6KA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 710-735 amino acids from human RPS6KA1.

Goat Polyclonal Antibody against AR

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence EVQLGLGRVYPRPPSC, from the N Terminus of the protein sequence according to NP_000035.

Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298)

Rabbit polyclonal antibody to Progesterone receptor (progesterone receptor)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 18 and 112 of Progesterone Receptor (Uniprot ID#P06401)

Rabbit Polyclonal antibody to SMC1A (structural maintenance of chromosomes 1A)

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 248 of SMC1A (Uniprot ID#Q14683)

Goat Anti-IGF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RSVRAQRHTD, from the internal region of the protein sequence according to NP_001104753.1; NP_001104754.1; NP_001104755.1; NP_000609.1.

Rabbit polyclonal CDC25C (Ser198) antibody(Phospho-specific)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CDC25C around the phosphorylation site of serine 198 (E-F-SP-L-K).
Modifications Phospho-specific

Rabbit polyclonal Androgen Receptor (Ab-213) antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Androgen Receptor around the phosphorylation site of serine 213 (E-A-SP-G-A).

Rabbit polyclonal anti-ADCY8 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCY8.

Rabbit polyclonal PKA CAT (Ab-197) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C).

Rabbit polyclonal CDC16/APC6 (Ser560) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P).
Modifications Phospho-specific

Rabbit polyclonal anti-APC1 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human APC1.

Rabbit Polyclonal APC6 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen APC6 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human APC6.

Rabbit Polyclonal APC10 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC10 antibody was raised against a 16 amino acid synthetic peptide near the center of human APC10.

Rabbit Polyclonal APC4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC4 antibody was raised against a 14 amino acid synthetic peptide near the amino terminus of human APC4.

Rabbit Polyclonal APC5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC5 antibody was raised against a 17 amino acid synthetic peptide near the center of human APC5.

Anti-CCNB1 (phospho-Ser147) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of Serine 147 (A-F-S(p)-D-V) derived from Human Cyclin B1.
Modifications Phospho-specific

Anti-CDC25C Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.214~218 (S-P-S-M-P) derived from Human cdc25C.

Anti-RPS6KA1 (Phospho-Thr348) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of threonine 348 (S-R-T(p)-P-R) derived from Human RPS6KA1.
Modifications Phospho-specific

Anti-YWHAZ (Phospho-Ser58) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 58 (R-S-S(p)-W-R) derived from Human 14-3-3 zeta.
Modifications Phospho-specific

Rabbit polyclonal FBXW11 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FBXW11 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-196 amino acids from the Central region of human FBXW11.

Rabbit polyclonal MAPK1 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human MAPK1.

Rabbit polyclonal MAPK3 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3.

Rabbit polyclonal MAPK1 Antibody (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 254-285 amino acids from the C-terminal region of human MAPK1.

CUL1 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CUL1

Rabbit Polyclonal Anti-CDK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM

Phospho-AURKA-T288 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T288 of human AURKA
Modifications Phospho-specific

Mouse Monoclonal PPP1A Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

PLK1 (C-term) Receptor Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PLK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 573-603 amino acids from the C-terminal region of human PLK1.
TA300014 is a replacement of TA300014-1.

Rabbit Polyclonal Antibody against CDC2 (T14)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1.

Rabbit Polyclonal Antibody against MAP2K1 (T291)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MAP2K1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 270-299 amino acids from human MAP2K1.

Rabbit Polyclonal APC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen APC1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human APC1.

Rabbit anti-IGF1R polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from humanIGF-1R around the phosphorylation site of tyrosine 1161 (D-I-YP-E-T).

Goat Anti-PP2A / PPP2R1A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KYFAQEALTVLSLA, from the C Terminus of the protein sequence according to NP_055040.2.

Rabbit polyclonal SMC1 (Ser957) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human SMC1 around the phosphorylation site of serine 957 (G-S-SP-Q-G)
Modifications Phospho-specific

Rabbit polyclonal anti-PPP2R1B antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPP2R1B.

Rabbit polyclonal Cyclin B1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Anti-Cyclin B1 antibody was produced by repeated immunizations of full length fusion protein corresponding to the human gene.

Rabbit polyclonal Plk1 phospho T210 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-Polo-like Kinase pT210 Antibody was produced by repeated immunizations with a synthetic phospho peptide corresponding to aa 205-214 of Human Polo-like kinase 1 (Plk1) protein.

Rabbit polyclonal anti-cdk2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Anti-cdk2 antbody was prepared from whole rabbit serum by repeated immunizations with a synthetic peptide corresponding to the C-terminus of the human cdk-2 protein conjugated to Keyhole Limpet Hemocyanin (KLH).

Rabbit polyclonal anti-Fbp5A antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the amino terminal end of human Fbp5A protein.

Rabbit polyclonal anti-MAD2L2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to aa 3-14 of Human MAD2L2. MAD2L2 is also known as MAD2B, REV7 and mitotic arrest deficient-like 2 protein.