Primary Antibodies

View as table Download

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

HK1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HK1

PKM2 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of human PKM2

Rabbit Polyclonal Anti-SOCS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA

Mouse Monoclonal anti-CACNA1C Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal IRS-1 (Ab-312) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A).

Rabbit Polyclonal Anti-IRS1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human IRS1

Rabbit Polyclonal Anti-Insulin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Insulin Antibody: A synthesized peptide derived from human Insulin

Rabbit Polyclonal Anti-ADIPOQ Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ADIPOQ

PI 3 Kinase p85 alpha (PIK3R1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 470-510 of Human PI3K p85α.

Rabbit Polyclonal Antibody against PIK3CA (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA.

Rabbit polyclonal PKC zeta (Thr410) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PKC? around the phosphorylation site of threonine 410 (T-S-TP-F-C).
Modifications Phospho-specific

Rabbit anti-HK2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HK2

Rabbit Polyclonal Anti-PKLR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKLR antibody: synthetic peptide directed towards the N terminal of human PKLR. Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE

Rabbit Polyclonal Anti-SOCS2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SOCS2

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

Rabbit anti-MTOR polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized non-phosphopeptide derived fromhuman mTOR around the phosphorylation site of serine 2448 (T-D-SP-Y-S).

Rabbit Polyclonal Glut4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human Glucose Transporter GLUT4 protein (between residues 480-509) [UniProt P14672]

Rabbit Polyclonal Glut2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human GLUT2 protein (between residues 50-150) [UniProt P11168]

Rabbit Monoclonal Antibody against FRAP1 (Clone Y391)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1.

Rabbit monoclonal antibody against IRS-2(clone EPR904(2))

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone D3E7 (5B6/6), Purified

Applications ELISA, IHC
Reactivities Bovine, Human, Mouse, Porcine, Rat

Rabbit Polyclonal Antibody against FRAP1 (S2481)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This mTOR (FRAP1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 2459-2488 amino acids from human mTOR (FRAP1).

IKBKB Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human IKBKB

Rabbit anti-PRKCE Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRKCE

JNK1 (MAPK8) mouse monoclonal antibody, clone 4H6, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human

JNK1 (MAPK8) mouse monoclonal antibody, clone 4H5, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human

Rabbit Polyclonal Antibody against PIK3CG (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KCG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 518-547 amino acids from the Central region of human PI3KCG.

Rabbit Polyclonal antibody to PIK3R3 (phosphoinositide-3-kinase, regulatory subunit 3 (gamma))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 192 and 427 of PIK3R3

Rabbit polyclonal PKCd (Ser645) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PKCd around the phosphorylation site of serine 645 (R-L-SP-Y-S).
Modifications Phospho-specific

Rabbit polyclonal IRS-1 (Ab-307) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 307 (T-E-S-I-T).

GLUT2 Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen SLC2A2 / GLUT2 antibody was raised against synthetic peptide C-RKEREEASSEQKVS from an internal region of human SLC2A2 / GLUT2 (NP_000331.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Panda, Bat, Rabbit, Horse, Pig (93%); Rat, Sheep, Elephant, Dog, Bovine (86%).

Anti-MAPK10 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 416-428 amino acids of Human mitogen-activated protein kinase 10

Rabbit polyclonal GCK Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GCK.

Rabbit polyclonal PIK3CG antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PIK3CG.

Mouse Monoclonal IKK beta Antibody (10AG2)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

JNK1 (MAPK8) mouse monoclonal antibody, clone 1A2, Purified

Applications ELISA, IHC, WB
Reactivities Human

JNK1 (MAPK8) mouse monoclonal antibody, clone 3B12, Purified

Applications ELISA, IHC, WB
Reactivities Human

JNK1 (MAPK8) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 380-420 of Human JNK3.

IRS1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

MTOR rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated