Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Calnexin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the rat Calnexin protein (between residues 550-591) [UniProt P35565] |
Rabbit Polyclonal ABCA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | Partial peptide sequence (peptide used resides somewhere between a.a 1100-1300) of the human ABCA1 gene. Actual immunogen sequence is proprietary information. |
Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | IHC, WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit polyclonal anti-Insig1 antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 248 of rat Insig1 |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Rabbit polyclonal anti-SCD (stearoyl-CoA desaturase) antibody
| Applications | WB |
| Reactivities | Hamster, Human, Mouse, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 206 of rat SCD |
Rabbit Polyclonal LIMPII/SR-B2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A peptide containing residues from mouse SR-BII (between residues 400-478) plus an N-terminal cysteine was coupled to KLH. [UniProt# O35114] |
Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | IHC, WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the N terminal of human KCNQ2. Synthetic peptide located within the following region: IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL |
Mouse Anti-Synaptobrevin (VAMP) Antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
Mouse Anti-Syntaxin Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Porcine, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-CANX Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Rabbit Polyclonal Anti-Calnexin -CT Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken (weak), Dog, Guinea pig, Hamster, Pig, Quail, Rabbit, Sheep, Drosophila (weak), Xenopus (weak) |
| Conjugation | Unconjugated |
| Immunogen | Dog Calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Rabbit Polyclonal Bcl-xL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Canine, Feline, Hamster, Porcin |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 1-50). [Swiss-Prot# Q07817] |
Rabbit Polyclonal Anti-Kcnq3 Antibody
| Applications | WB |
| Reactivities | Hamster, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Kcnq3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ |
Rabbit Polyclonal Anti-KCNQ4 Antibody
| Applications | WB |
| Reactivities | Hamster, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ4 antibody: synthetic peptide directed towards the middle region of human KCNQ4. Synthetic peptide located within the following region: SSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQ |
Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS |
Active filters
Reactivities
- Hamster
Applications
- WB
Families
- Transmembrane
Filter by
Category
Target Symbol
Antibody Hosts
Clonalities
Conjugates
Pathways
- Antigen processing and presentation (6)
- Vibrio cholerae infection (3)
- ABC transporters (2)
- Lysosome (2)
- SNARE interactions in vesicular transport (2)
- Alzheimer's disease (1)
- Amyotrophic lateral sclerosis (ALS) (1)
- Apoptosis (1)
- Biosynthesis of unsaturated fatty acids (1)
- Cardiac muscle contraction (1)
- Chronic myeloid leukemia (1)
- Cytokine-cytokine receptor interaction (1)
- Endocytosis (1)
- Focal adhesion (1)
- Huntington's disease (1)
- Jak-STAT signaling pathway (1)
- Metabolic pathways (1)
- Oxidative phosphorylation (1)
- PPAR signaling pathway (1)
- Pancreatic cancer (1)
- Parkinson's disease (1)
- Pathways in cancer (1)
- Small cell lung cancer (1)
- VEGF signaling pathway (1)