Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal antibody to AChE (acetylcholinesterase (Yt blood group))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 406 and 614 of AChE (Uniprot ID#P22303) |
Rabbit polyclonal anti-DGKA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKA. |
Rabbit polyclonal anti-LYPLA1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LYPLA1. |
Rabbit polyclonal anti-DGKB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKB. |
Rabbit polyclonal anti-CHKB antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CHKB. |
Rabbit polyclonal anti-DGKQ antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKQ. |
Rabbit polyclonal anti-DGKE antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKE. |
Rabbit polyclonal anti-EKI2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EKI2. |
Anti-PPAP2C Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-269 amino acids of human phosphatidic acid phosphatase type 2C |
Rabbit Polyclonal c-PLA2 (Ser505) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-PLA2 around the phosphorylation site of Serine 505 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-LYCAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYCAT antibody: synthetic peptide directed towards the middle region of human LYCAT. Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE |
Rabbit Polyclonal Anti-PLA2G4E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G4E antibody: synthetic peptide directed towards the c terminal of human PLA2G4E. Synthetic peptide located within the following region: TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT |
Rabbit Polyclonal Anti-DGKH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: EPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQT |
PPAP2C (PLPP2) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human, Porcine |
| Immunogen | Synthetic peptide derived from the lipid phosphate phosphohydrolase 2 protein |
USD 360.00
5 Days
Phosphatidic acid phosphatase type 2B (PLPP3) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide derived from the phosphatidic acid phosphatase 2B protein |
DGKE rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
Rabbit polyclonal antibody to Phospholipase A2 XIIA (phospholipase A2, group XIIA)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 22 and 115 of PLA2G12A (Uniprot ID#Q9BZM1) |
Rabbit polyclonal anti-DGKD antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKD. |
Rabbit Polyclonal anti-PPAP2A antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV |
Rabbit polyclonal Anti-CRLS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRLS1 antibody: synthetic peptide directed towards the middle region of human CRLS1. Synthetic peptide located within the following region: WTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARN |
Rabbit Polyclonal Anti-PEMT Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PEMT Antibody: synthetic peptide directed towards the C terminal of human PEMT. Synthetic peptide located within the following region: GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS |
Rabbit Polyclonal Anti-GPD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPD2 antibody: synthetic peptide directed towards the N terminal of human GPD2. Synthetic peptide located within the following region: DILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR |
Rabbit Polyclonal Anti-PLD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PLD2 Antibody: synthetic peptide directed towards the N terminal of human PLD2. Synthetic peptide located within the following region: MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQ |
Rabbit Polyclonal Anti-DGKH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW |
Rabbit Polyclonal Anti-DGKD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKD antibody is: synthetic peptide directed towards the C-terminal region of Human DGKD. Synthetic peptide located within the following region: KRSRSGKFRLVTKFKKEKNNKNKEAHSSLGAPVHLWGTEEVAAWLEHLSL |
Rabbit Polyclonal Anti-DGKE Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKE antibody: synthetic peptide directed towards the N terminal of human DGKE. Synthetic peptide located within the following region: EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR |
Rabbit Polyclonal Anti-CDS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDS2 antibody is: synthetic peptide directed towards the C-terminal region of Human CDS2. Synthetic peptide located within the following region: EYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIA |
Rabbit Polyclonal Anti-PTDSS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTDSS2 antibody: synthetic peptide directed towards the N terminal of human PTDSS2. Synthetic peptide located within the following region: GQATGPGEGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCTLGYVTLLEE |
Rabbit Polyclonal Anti-DGKQ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKQ antibody: synthetic peptide directed towards the middle region of human DGKQ. Synthetic peptide located within the following region: DAELSLDFHQAREEEPGKFTSRLHNKGVYVRVGLQKISHSRSLHKQIRLQ |
Rabbit Polyclonal Anti-PTDSS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTDSS1 antibody: synthetic peptide directed towards the N terminal of human PTDSS1. Synthetic peptide located within the following region: MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI |
Rabbit Polyclonal Anti-GDE1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GDE1 antibody: synthetic peptide directed towards the N terminal of human GDE1. Synthetic peptide located within the following region: LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN |
Rabbit Polyclonal Anti-AGPAT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGPAT3 antibody: synthetic peptide directed towards the middle region of human AGPAT3. Synthetic peptide located within the following region: KRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAA |
Rabbit Polyclonal Anti-AGPAT4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGPAT4 antibody: synthetic peptide directed towards the middle region of human AGPAT4. Synthetic peptide located within the following region: EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM |
GNPAT (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human GNPAT |
Phospholipase A2 (PLA2G4A) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human PLA2G4A |
AGPAT3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human AGPAT3 |
1 AGP acyltransferase 4 (AGPAT4) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human AGPAT4 |
GPAT4 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 52~82 amino acids from the N-terminal region of human AGPAT6 |
Active filters
Applications
- WB
Pathways
- Glycerophospholipid metabolism
Filter by
Category
Target Symbol
- DGKA (37)
- PISD (32)
- GNPAT (23)
- PLA2G3 (17)
- PLA2G6 (12)
- ACHE (10)
- PLPP1 (9)
- PLA2G2A (7)
- DGKB (6)
- DGKZ (6)
- GPD1 (6)
- CHAT (5)
- GPAT4 (5)
- GPD2 (5)
- PLA2G4A (5)
- PNPLA3 (5)
- DGKD (4)
- LCAT (4)
- PLD2 (4)
- AGPAT2 (3)
- AGPAT3 (3)
- AGPAT4 (3)
- CDS1 (3)
- DGKE (3)
- GPAM (3)
- PLA2G5 (3)
- PLPP2 (3)
- PTDSS2 (3)
- CRLS1 (2)
- DGKH (2)
- DGKI (2)
- DGKQ (2)
- ETNK2 (2)
- GPD1L (2)
- JMJD7-PLA2G4B (2)
- LYPLA1 (2)
- NAA80 (2)
- NAT6 (2)
- PCYT2 (2)
- PGS1 (2)
- PLA2G12A (2)
- CDS2 (1)
- CHKA (1)
- CHKB (1)
- CHPT1 (1)
- GDE1 (1)
- LCLAT1 (1)
- LYPLA2 (1)
- NAA10 (1)
- PCYT1A (1)
- PEMT (1)
- PHOSPHO1 (1)
- PLA2G12B (1)
- PLA2G1B (1)
- PLA2G2C (1)
- PLA2G2D (1)
- PLA2G2E (1)
- PLA2G4E (1)
- PLD1 (1)
- PLPP3 (1)
- PTDSS1 (1)