NT5E Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NT5E |
NT5E Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NT5E |
Adenylate cyclase 1 (ADCY1) (aa 230-280) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 230-280 of Human ADCY 1. |
Rabbit Polyclonal Anti-ADCY6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY |
GUCY2D (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 540-570 amino acids from the Central region of human GUCY2D / RETGC1 |
Rabbit Polyclonal p53R2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | p53R2 antibody was raised against a synthetic peptide corresponding to amino acids 2 to 17 of human p53R2 . |
Rabbit polyclonal anti-PDE3B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 948 of mouse PDE3B. |
ADCY5 (+ADCY6) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 1111-1160 of Human ADCY 5. |
PDE3B (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IF, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 400-427 amino acids from the Central region of Human PDE3B |
Rabbit polyclonal anti-ADCY5/6 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY5/6. |
Rabbit Polyclonal Anti-NT5C3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NT5C3 Antibody: A synthesized peptide derived from human NT5C3 |
ENPP3 mouse monoclonal antibody, clone NP4D6, Aff - Purified
Applications | FC, IF, IHC |
Reactivities | Human |
CD73 (NT5E) (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | NT5E antibody was raised against kLH conjugated synthetic peptide between 520-550 amino acids from the C-terminal region of human CD73 (NT5E). |
ENTPD2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 92~122 amino acids from the N-terminal region of Human ENTPD2. |
ENTPD3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 499-531 amino acids from the C-terminal region of Human ENTPD3. |
Rabbit Polyclonal antibody to ENTPD6 (ectonucleoside triphosphate diphosphohydrolase 6 (putative function))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 114 and 285 of ENTPD6 |
Rabbit Polyclonal Adenylate Cyclase 3 Antibody
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Raised against a 20 amino acid peptide corresponding to the C-terminus of rat Adenylate Cyclase 3 (PAAFPNGSSVTLPHQVVDNP). |
Goat Anti-ENPP1 / PC1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KTHLPTFSQED, from the C Terminus of the protein sequence according to NP_006199.2. |
Rabbit polyclonal anti-ADCY5/ADCY6 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthetic peptide derived from internal of human ADCY5/ADCY6. (UniProt O95622 and O43306). |
Rabbit polyclonal anti-ADCY8 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY8. |
PDE3A Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | PDE3A antibody was raised against synthetic 19 amino acid peptide from near N-terminus of human PDE3A. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (94%). |
ENPP3 mouse monoclonal antibody, clone NP4D6, PE
Applications | FC, IF |
Reactivities | Human |
Conjugation | PE |
ADCY2 (Center) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 458-489 amino acids from the Central region of human ADCY2 |
ADCY4 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 421~450 amino acids from the Central region of human ADCY4 |
Rabbit Polyclonal T-cadherin Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | T-cadherin antibody was raised against a 15 amino acid peptide from near the amino terminus of human T-cadherin. |
Rabbit polyclonal antibody to ENTPD5(CD39L4) (ectonucleoside triphosphate diphosphohydrolase 5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 191 of ENTPD5 (Uniprot ID#O75356) |
Rabbit polyclonal antibody to ENTPD3 (ectonucleoside triphosphate diphosphohydrolase 3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 200 and 459 of ENTPD3 (Uniprot ID#O75355) |
Rabbit anti-ADCY6 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH |
Rabbit polyclonal anti-ADCY1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY1. |
Rabbit polyclonal anti-RRM2B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human RRM2B. |
ENTPD2 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | ENTPD2 antibody was raised against synthetic 17 amino acid peptide from internal region of human ENTPD2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Panda, Dog, Horse (94%); Marmoset, Mouse, Rat, Hamster, Elephant, Bovine (88%); Opossum, Xenopus (82%). |
Rabbit polyclonal RRM2B p53R2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-Human RRM2B/p53R2 antibody was prepared by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human RRM2B1 protein. A residue of cysteine was added to facilitate coupling. |
Mouse monoclonal CD73(NT5E) Antibody (C-term)(Ascites)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD73 (NT5E) mouse monoclonal antibody, clone AD2, Purified
Applications | FC |
Reactivities | Human |
CD39 (ENTPD1) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-ADCY2 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH |
Rabbit anti-ADCY9 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH |
Rabbit polyclonal anti-NT5E antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human NT5E. |
Rabbit polyclonal anti-ADCY4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY4. |
CD203c Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Dog, Human, Monkey, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset, Dog (100%); Bovine, Horse, Pig (95%); Panda, Bat (84%). |
CD203c Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from C-Terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan (100%); Chimpanzee (95%); Gibbon, Hamster (89%); Monkey (84%). |
CD203c Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Monkey, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Monkey (100%); Gibbon (95%); Rat, Rabbit, Pig (80%). |
CD203c Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Human |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Orangutan, Marmoset (95%); Horse, Rabbit (84%). |
PDE3A Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | PDE3A antibody was raised against synthetic 18 amino acid peptide from N-terminus of human PDE3A. Percent identity with other species by BLAST analysis: Human (100%); Gibbon, Monkey (94%); Horse (83%). |
PDE3A Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Human, Monkey, Mouse, Rat, Horse, Gibbon |
Immunogen | PDE3A antibody was raised against synthetic 17 amino acid peptide from internal region of human PDE3A. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Horse, Opossum (100%); Chicken (88%). |
ENTPD2 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | ENTPD2 antibody was raised against synthetic 18 amino acid peptide from internal region of human ENTPD2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (94%); Gibbon, Bovine (89%); Elephant, Panda (83%). |
ENTPD2 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Chimpanzee, Human, Monkey, Orang-Utan, Gorilla, Gibbon |
Immunogen | ENTPD2 antibody was raised against synthetic 15 amino acid peptide from internal region of human ENTPD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Galago, Hamster (80%). |
ENTPD2 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Chimpanzee, Human, Monkey |
Conjugation | Unconjugated |
Immunogen | ENTPD2 antibody was raised against synthetic 14 amino acid peptide from internal region of human ENTPD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gibbon, Monkey (100%); Gorilla, Bovine, Horse (93%); Galago, Elephant, Guinea pig (86%). |
Rabbit Polyclonal Anti-NT5C3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NT5C3 antibody: synthetic peptide directed towards the middle region of human NT5C3. Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII |
Rabbit Polyclonal Anti-ENTPD6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENTPD6 Antibody is: synthetic peptide directed towards the C-terminal region of Human ENTPD6. Synthetic peptide located within the following region: ALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSP |
Rabbit Polyclonal Anti-PDE3A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDE3A antibody: synthetic peptide directed towards the N terminal of human PDE3A. Synthetic peptide located within the following region: LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD |