Germany
Japan
United Kingdom
China
SFRS5 (SRSF5) (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human SFRS5 |
Primary Antibodies
View as table Download
SNRPD2 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human SNRPD2 |
SC35 (SRSF2) (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from aa 83-113 from the Center region of human SFRS2 |
LSM7 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 52-80 amino acids from the C-terminal region of human LSM7 |
PLRG1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 16-45 amino acids from the N-terminal region of Human PLRG1 |
SF3B2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 515-545 amino acids from the Central region of Human SF3B2 |
SF3B3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1053-1082 amino acids from the C-terminal region of Human SF3B3. |
SFRS3 (SRSF3) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 81-110 amino acids from the Central region of Human SFRS3 |
SNRPD3 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 8-38 amino acids from the N-terminal region of human SNRPD3 |
USD 450.00
2 Weeks
Aly (ALYREF) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 59-89 amino acids from the Central region of human THOC4 |
TRA2B (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 207-237 amino acids from the Central region of human TRA2B |
ZMAT2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 161-190 amino acids from the C-terminal region of human ZMAT2 |
Goat Polyclonal Antibody against SAP130 / SF3B3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-VSKKLEDIRTRYAF, from the C Terminus of the protein sequence according to NP_036558.3. |
Goat Polyclonal Antibody against XAB2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SVPAAVFGSLKED, from the C Terminus of the protein sequence according to NP_064581.2. |
Goat Polyclonal Antibody against SF3B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AAGPISERNQDAT-C, from the N Terminus of the protein sequence according to NP_005841.1. |
Goat Polyclonal Antibody against SYF2
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AEIKQNLERGTAV, from the C Terminus of the protein sequence according to NP_056299. |
Rabbit Polyclonal Acinus Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Acinus antibody was raised against a peptide corresponding to amino acids 994 to 1009 of human AcinusL, 267 to 282 of human AcinusS’, or 236 to 251 of human AcinusS, which are identical to those of mouse Acinus. The selected antigenic sequence is located near the N-terminus of active peptide p17. |
Rabbit polyclonal antibody to SART1 (squamous cell carcinoma antigen recognized by T cells)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 533 and 792 of SART1 (Uniprot ID#O43290) |
Rabbit Polyclonal antibody to Nuclear Matrix Protein p84 (THO complex 1)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 404 of Nuclear Matrix Protein p84 |
Chicken Polyclonal anti-HSPA1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length Human Hsp70 |
Goat Anti-LSM2 (aa33-46) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DQYLNIKLTDISVT, from the internal region of the protein sequence according to NP_067000.1. |
Goat Anti-PCBP1 (aa234-247) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ADLAKLNQVARQQSH, from the internal region of the protein sequence according to CAA55016.1. |
Rabbit polyclonal anti-BCAS2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human BCAS2. |
Rabbit polyclonal anti-SFRS4 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SFRS4 |
Anti-HNRNPA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.190~194(S-S-S-Q-R)derived from Human hnRNP A1. |
Anti-HNRNPK Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 280 amino acids of human heterogeneous nuclear ribonucleoprotein K |
Rabbit Polyclonal Anti-PRPF19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the N terminal of human PRPF19. Synthetic peptide located within the following region: VPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP |
Rabbit Polyclonal Anti-PQBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PQBP1 antibody: synthetic peptide directed towards the middle region of human PQBP1. Synthetic peptide located within the following region: LVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSH |
Rabbit Polyclonal Anti-TCERG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCERG1 antibody: synthetic peptide directed towards the middle region of human TCERG1. Synthetic peptide located within the following region: LLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIK |
Rabbit polyclonal Anti-DHX16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHX16 antibody: synthetic peptide directed towards the N terminal of human DHX16. Synthetic peptide located within the following region: KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPV |
Rabbit polyclonal Anti-DDX46 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX46 antibody: synthetic peptide directed towards the C terminal of human DDX46. Synthetic peptide located within the following region: GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL |
Rabbit Polyclonal Anti-CCDC12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CCDC12 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC12. Synthetic peptide located within the following region: EQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAE |
Rabbit Polyclonal Anti-PRPF38B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PRPF38B Antibody is: synthetic peptide directed towards the middle region of Human PRPF38B. Synthetic peptide located within the following region: VQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGG |
Rabbit Polyclonal Anti-CRNKL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CRNKL1 Antibody is: synthetic peptide directed towards the C-terminal region of Human CRNKL1. Synthetic peptide located within the following region: SFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPED |
Rabbit Polyclonal Anti-SNRNP40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SNRNP40 Antibody is: synthetic peptide directed towards the middle region of Human SNRNP40. Synthetic peptide located within the following region: SASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGT |
Rabbit Polyclonal Anti-PLRG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PLRG1 Antibody: synthetic peptide directed towards the N terminal of human PLRG1. Synthetic peptide located within the following region: YGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYP |
Rabbit Polyclonal Anti-HSPA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HSPA2 Antibody: synthetic peptide directed towards the middle region of human HSPA2. Synthetic peptide located within the following region: ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIK |
Rabbit Polyclonal Anti-LSM5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LSM5 Antibody is: synthetic peptide directed towards the middle region of Human LSM5. Synthetic peptide located within the following region: GFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV |
Rabbit Polyclonal Anti-HSPA6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA6 antibody: synthetic peptide directed towards the middle region of human HSPA6. Synthetic peptide located within the following region: EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV |
Rabbit Polyclonal Anti-HSPA1L Antibody
| Applications | WB |
| Reactivities | Human, Lamprey, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HSPA1L Antibody: synthetic peptide directed towards the C terminal of human HSPA1L. Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD |
Rabbit Polyclonal Anti-EFTUD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EFTUD2 Antibody is: synthetic peptide directed towards the middle region of Human EFTUD2. Synthetic peptide located within the following region: ADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPL |
Rabbit Polyclonal Anti-SFRS7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SFRS7 Antibody: synthetic peptide directed towards the N terminal of human SFRS7. Synthetic peptide located within the following region: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA |
Rabbit Polyclonal Anti-SFRS7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SFRS7 Antibody: synthetic peptide directed towards the middle region of human SFRS7. Synthetic peptide located within the following region: SRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSP |
Rabbit Polyclonal Acinus Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | C-terminus of Acinus (proprietary peptide). |
Rabbit Polyclonal Anti-HNRNPC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HNRNPC antibody is: synthetic peptide directed towards the C-terminal region of Human HNRNPC. Synthetic peptide located within the following region: ADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS |
Rabbit Polyclonal Anti-HNRNPC Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HNRNPC antibody is: synthetic peptide directed towards the middle region of Human HNRNPC. Synthetic peptide located within the following region: VDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGG |
Rabbit Polyclonal Anti-PPIL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPIL1 antibody is: synthetic peptide directed towards the N-terminal region of Human PPIL1. Synthetic peptide located within the following region: YWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASI |
Active filters
Clonalities
- Polyclonal
Pathways
- Spliceosome
Filter by
Category
Target Symbol
- HSPA1A (14)
- HNRNPC (13)
- ACIN1 (9)
- BCAS2 (7)
- HSPA8 (7)
- ALYREF (5)
- DDX39B (5)
- DDX5 (5)
- HNRNPA1 (5)
- HNRNPK (5)
- PUF60 (5)
- RBMX (5)
- SF3B3 (5)
- SRSF1 (5)
- CTNNBL1 (4)
- HNRNPM (4)
- PCBP1 (4)
- SART1 (4)
- SF3B1 (4)
- SF3B4 (4)
- SRSF10 (4)
- SRSF3 (4)
- SRSF7 (4)
- THOC1 (4)
- BUD31 (3)
- CDC5L (3)
- NCBP1 (3)
- PPIL1 (3)
- PRPF18 (3)
- PRPF19 (3)
- PRPF31 (3)
- RBM22 (3)
- SF3B6 (3)
- SMNDC1 (3)
- SNRNP70 (3)
- SNRPA (3)
- SNRPB (3)
- SNRPD2 (3)
- SNRPE (3)
- SRSF4 (3)
- TRA2B (3)
- U2AF2 (3)
- USP39 (3)
- XAB2 (3)
- ZMAT2 (3)
- CDC40 (2)
- CHERP (2)
- DDX23 (2)
- DDX46 (2)
- DHX15 (2)
- DHX16 (2)
- DHX8 (2)
- EFTUD2 (2)
- EIF4A3 (2)
- HNRNPA1L2 (2)
- HNRNPA3 (2)
- HNRNPU (2)
- HSPA1L (2)
- HSPA6 (2)
- LSM2 (2)
- LSM4 (2)
- LSM6 (2)
- MAGOH (2)
- MAGOHB (2)
- PLRG1 (2)
- PPIE (2)
- PPIH (2)
- PQBP1 (2)
- PRPF3 (2)
- PRPF38A (2)
- PRPF6 (2)
- SF3A1 (2)
- SLU7 (2)
- SNRPD3 (2)
- SNRPF (2)
- SNU13 (2)
- SNW1 (2)
- SRSF2 (2)
- SRSF5 (2)
- SRSF8 (2)
- TCERG1 (2)
- THOC3 (2)
- TRA2A (2)
- U2AF1 (2)
- U2SURP (2)
- WBP11 (2)
- AQR (1)
- CCDC12 (1)
- CRNKL1 (1)
- DDX42 (1)
- DHX38 (1)
- HSPA1B (1)
- HSPA2 (1)
- LSM5 (1)
- LSM7 (1)
- LSM8 (1)
- NCBP2 (1)
- PHF5A (1)
- PRPF38B (1)
- PRPF4 (1)
Reactivities
- Human (269)
- Mouse (98)
- Rat (72)
- Dog (13)
- Cow (12)
- Bovine (9)
- Pig (8)
- Hamster (4)
- Zebrafish (4)
- Monkey (3)
- Sheep (2)
- Xenopus (2)
- Beluga (1)
- C. elegans (1)
- Carp (1)
- Chicken (1)
- Chimpanzee (1)
- Coral (1)
- Dogfish (1)
- Drosophila (1)
- Fish (1)
- Guinea Pig (1)
- Hagfish (1)
- Porcine (1)
- Rhesus Monkey (1)
- Tobacco (1)
- Tomato (1)
- Yeast (1)