Primary Antibodies

View as table Download

Rabbit anti-ENO1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ENO1

Rabbit polyclonal ENOA Antibody (N-term)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA.

Rabbit anti-HSPD1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HSPD1

Mouse monoclonal Hsp60 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Guinea Pig, Hamster, Monkey, Pig, Rabbit, Spinach, E.coli (GroEl), H. pylori, S. typhimurium, T. spiralis, yeast, white fly
Conjugation Unconjugated

Non Neuronal Enolase (ENO1) (178-205) rabbit polyclonal antibody, Ig Fraction

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1.

Hsp60 (HSPD1) goat polyclonal antibody, Purified

Applications IHC, IP, WB
Reactivities Bacteria, Bovine, Canine, Drosophila, Fish, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus
Immunogen HSPD1 antibody was raised against recombinant human HSP60.

Rabbit polyclonal anti-HSP60 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HSP60.

Rabbit polyclonal anti-HSPD1(HSP60) antibody(Center), Loading control

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-215 amino acids from the Central region of human HSPD1.

Non Neuronal Enolase (ENO1) mouse monoclonal antibody, clone NSE-P1, Purified

Applications ELISA, IHC, WB
Reactivities Human

Hsp60 (HSPD1) rabbit polyclonal antibody

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Hsp60 (HSPD1) rabbit polyclonal antibody

Applications FC, IF, IHC, WB
Reactivities Mouse, Primate, Rat
Conjugation Unconjugated

Rabbit Polyclonal antibody to ENO1 (enolase 1, (alpha))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 199 and 434 of ENO1 (Uniprot ID#P06733)

Rabbit polyclonal ENO1 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1.

Rabbit Polyclonal HSP60 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Hamster, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 300-360). [Swiss-Prot P10809]

Rabbit Polyclonal Anti-HSP60 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSP60 Antibody: A synthesized peptide derived from human HSP60

Hsp60 (HSPD1) mouse monoclonal antibody, clone SJ-60, Purified

Applications IHC, IP, WB
Reactivities Chicken, Human, Rat

Hsp60 (HSPD1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide mapping at the middle region of human HSP60

Rabbit polyclonal HSPD1 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-423 amino acids from the C-terminal region of human HSPD1.

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP

Rabbit Polyclonal HSP60 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Hamster, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 70-150). [Swiss-Prot P10809]

Mouse Monoclonal Hsp60 Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CNOT4 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Non Neuronal Enolase (ENO1) (N-term) rabbit polyclonal antibody, Ig Fraction

Applications IHC, WB
Reactivities Human
Immunogen kLH conjugated synthetic peptide selected from the N-terminal region of Human ENO1.

CNOT4 (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen CNOT4 antibody was raised against cNOT4 antibody was raised against a 19 amino acid peptide near the amino terminus of the human CNOT4.

Mouse monoclonal Hsp60 Antibody

Applications IHC, WB
Reactivities Bovine, Canine, Chicken, Drosophila, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig
Conjugation Unconjugated

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: GSGGMTHSDQPKEDRQGVNEKSCNCLLLKVNQIGSVTESLQACKLAQANG

Rabbit Polyclonal CNOT4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Xenopus
Conjugation Unconjugated
Immunogen A portion of amino acids 50-100 of human CNOT4 was used as the immunogen for the antibody.

Rabbit Polyclonal Antibody against CNOT4 (N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CNOT4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-84 amino acids from the N-terminal region of human CNOT4.

Goat Anti-C1D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SKNASKVANKGKSKS, from the C Terminus of the protein sequence according to NP_775269.1.

Rabbit Polyclonal CNOT4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CNOT4 antibody was raised against a 19 amino acid peptide near the amino terminus of the human CNOT4.

Rabbit polyclonal Hsp60 Antibody

Applications WB
Reactivities Bovine, Canine, Chicken, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Human Hsp60 produced through recombinant DNA methods in E.coli

Rabbit Polyclonal Anti-ENO1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELR

Rabbit Polyclonal Anti-C1D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1D antibody: synthetic peptide directed towards the N terminal of human C1D. Synthetic peptide located within the following region: AGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLE

Rabbit Polyclonal Anti-C1D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1D antibody: synthetic peptide directed towards the middle region of human C1D. Synthetic peptide located within the following region: LDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNR

Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI3D11 (formerly 3D11)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI4B2 (formerly 4B2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI4C7 (formerly 4C7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI3B8 (formerly 3B8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) CNOT4 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI7D7 (formerly 7D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HSPD1 mouse monoclonal antibody,clone OTI4E4

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated