Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
IL10 mouse monoclonal antibody, clone B-S10, Azide Free
| Applications | ELISA, FN |
| Reactivities | Human |
Goat Polyclonal Anti-IL10 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human IL10 produced in E. coli. |
FAS Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FAS |
IL10 mouse monoclonal antibody, clone BN-10, FITC
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | FITC |
Mouse Anti-Human CD95 (APO-1/Fas) Purified
| Applications | FC |
| Reactivities | Human |
IL10 mouse monoclonal antibody, clone BN-10, PE
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | PE |
CD95 (FAS) (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | conjugated synthetic peptide selected from the Center region of human FAS |
CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.323~327 derived from human Fas . |
CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.323~327 derived from human Fas . |
Goat Anti-FAS / CD95 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1. |
Rabbit polyclonal anti-IL-10 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The whole rabbit serum was prepared by repeated immunizations with human IL-10. |
Rabbit Polyclonal Anti-FAIM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD |
Mouse Monoclonal FAS (C-terminus) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-10 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IL-10 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | For immunization recombinant human IL-10 (E.coli-derived) is used |
Rabbit anti CD95 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse anti IL-10 Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMURF2 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL10 mouse monoclonal antibody,clone OTI9H3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 399.00
In Stock
SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SMURF2 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SMURF2 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
SMURF2 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SMURF2 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Families
- ES Cell Differentiation/IPS
Pathways
- Allograft rejection