Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit anti-ANPEP Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ANPEP |
USD 380.00
4 Weeks
Mouse Monoclonal Angiotensin Converting Enzyme 1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ACE1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACE1 Antibody: A synthesized peptide derived from human ACE1 |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, Biotin
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | Biotin |
Rabbit Polyclonal Anti-ANPEP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Azide Free
| Applications | FC |
| Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Purified
| Applications | FC |
| Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, APC
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | APC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, FITC
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, PE
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | PE |
Mouse Anti-Human CD13 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2 |
Goat Anti-CD13 / ANPEP Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2 |
USD 465.00
4 Weeks
USD 465.00
4 Weeks
Anti-ACE1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 78-92 amino acids of Human Angiotensin-converting enzyme |
Anti-ACE1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 78-92 amino acids of Human Angiotensin-converting enzyme |
Rabbit Polyclonal Anti-ANPEP Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ANPEP |
Rabbit Polyclonal Anti-ACE Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACE |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Families
- ES Cell Differentiation/IPS
Pathways
- Renin-angiotensin system