Rabbit Polyclonal CCR5 (Ser336) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CCR5 around the phosphorylation site of Serine 336 |
| Modifications | Phospho-specific |
Rabbit Polyclonal CCR5 Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CCR5 |
CCR7 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide, corresponding to amino acids 280-330 of Human CCR7. |
CCR7 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence mapping at the C-terminal of human CCR7 |
CXCR4 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human CXCR4 |
Mouse anti-CCR4 monoclonal antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-CXCR3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CXCR3. |
CCR1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | CCR1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human CCR1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Bovine (95%); Mouse (85%); Marmoset (80%). |
Mouse Anti-Human CD181 (CXCR1) Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CXCR5 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXCR5 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human CXCR5. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Hamster (94%); Gibbon, Mouse, Rat, Dog, Bovine, Panda, Pig (89%). |
CXCR4 mouse monoclonal antibody, clone B-R24, Purified
| Applications | FC |
| Reactivities | Human |
CCR3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CCR3 |
CCR4 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Immunogen | Synthetic peptide surrounding amino acid 32 of human CCR4 |
CCXCR1 (XCR1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 302-333 amino acids from the C-terminal region of human XCR1 |
Rabbit Polyclonal CCR3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CCR3 antibody was raised against a 14 amino acid peptide from near the amino terminus of human CCR3. |
Rabbit Polyclonal Bonzo Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Bonzo antibody was raised against a peptide corresponding to amino acids 319 to 338 of human origin. The sequence of this peptide is identical to those of macaque and African green monkey. |
Rabbit Polyclonal CCR8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR8 antibody was raised against a peptide corresponding to amino acids 183 to 201 of human CCR8, which locate in the second extracellular loop. |
Goat Anti-CXCR6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SEDNSKTFSASHN, from the C Terminus of the protein sequence according to NP_006555.1. |
Rabbit polyclonal CCR5 (Ser336) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CCR5 around the phosphorylation site of serine 336 (R-A-SP-S-V). |
| Modifications | Phospho-specific |
CCR1 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | CCR1 antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human CCR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Hamster (89%); Marmoset, Mouse (83%). |
CXCR1 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human |
| Immunogen | CXCR1 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human CXCR1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Orangutan, Monkey, Marmoset (94%); Gibbon, Rabbit (88%). |
XCR1 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | XCR1 antibody was raised against synthetic 20 amino acid peptide from C-terminal cytoplasmic domain of human XCR1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon (95%); Monkey (90%). |
CCR3 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | CCR3 antibody was raised against synthetic 16 amino acid peptide from 3rd extracellular domain of human CCR3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (88%). |
Mouse Anti-Human CD195 (CCR5) Purified (25 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal IL-8R beta/CDw128 beta (Ser347) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of Serine 347 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CXCR6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCR6 antibody: synthetic peptide directed towards the N terminal of human CXCR6. Synthetic peptide located within the following region: AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL |
Rabbit Polyclonal Anti-CCR8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCR8 antibody: synthetic peptide directed towards the middle region of human CCR8. Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT |
Goat Anti-CXCR1 (aa26-38) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DYSPCMLETETLN, from the internal region (near N terminus) of the protein sequence according to NP_000625.1. |
Rabbit Polyclonal CXCR3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against a synthetic peptide corresponding to amino acids 290-303 of human CXCR3. |
Rabbit Polyclonal CCR1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to the 2nd extracellular domain of human C-C Chemokine Receptor 1 (CCR1) |
Rabbit Polyclonal Anti-CXCR4 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human CXCR4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Rabbit, Opossum, Turkey, Chicken, Platypus, Lizard (100%). |
Rabbit Polyclonal Anti-CXCR5 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXCR5 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CXCR5. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Rat, Dog, Bovine, Hamster, Panda, Rabbit, Pig (94%). |
Rabbit Polyclonal Anti-CCR7 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR7 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CCR7. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine (100%); Dog (95%); Marmoset, Panda, Bat (89%); Horse, Rabbit, Pig (84%). |
Rabbit Polyclonal Anti-CCR9 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR9 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human CCR9. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Sheep, Bovine, Bat, Pig (100%); Monkey, Ferret, Panda, Dog, Horse, Opossum (94%); Elephant (88%). |
Rabbit Polyclonal Anti-CXCR2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXCR2 antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human CXCR2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Monkey (88%). |
Rabbit Polyclonal Anti-CXCR4 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human CXCR4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset, Tamarin, Mouse, Rat, Bat, Bovine, Dog, Cat, Hamster, Panda, Rabbit, Horse, Pig, Opossum, Lizard (100%); Elephant, Turkey, Chicken (94%). |
Rabbit Polyclonal Anti-CCR8 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR8 antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human CCR8. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Marmoset, Elephant, Panda (83%). |
Rabbit Polyclonal Anti-CX3CR1 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against synthetic 19 amino acid peptide from 3rd extracellular domain of human CX3CR1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (95%); Marmoset, Mouse, Panda (84%). |
Rabbit Polyclonal Anti-CXCR2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXCR2 antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human CXCR2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gibbon (100%); Gorilla (94%); Marmoset (88%). |
Rabbit Polyclonal Anti-CCR7 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR7 antibody was raised against synthetic 16 amino acid peptide from 1st extracellular domain of human CCR7. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Bovine, Pig (94%); Marmoset, Elephant, Bat, Horse, Rabbit (88%); Panda, Dog (81%). |
Goat Anti-CX3CR1 (aa34-47) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DQFPESVTENFEYD, from the internal region (near N terminus) of the protein sequence according to NP_001164645.1; NP_001328.1. |
Rabbit anti CCR10 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to N-terminal of human CCR10. |
Germany
Japan
United Kingdom
China
