Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal anti-HSPD1(HSP60) antibody(Center), Loading control
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-215 amino acids from the Central region of human HSPD1. |
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit polyclonal PCNA Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit Polyclonal HSP60 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 300-360). [Swiss-Prot P10809] |
Rabbit polyclonal STIP1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 269-297 amino acids from the Central region of human STIP1. |
Rabbit polyclonal HSPD1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-423 amino acids from the C-terminal region of human HSPD1. |
Rabbit polyclonal HMGA1 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HMGA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 64-93 amino acids from the C-terminal region of human HMGA1. |
Rabbit Polyclonal HSP60 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 70-150). [Swiss-Prot P10809] |
Rabbit polyclonal STIP1 Antibody (C-term)
| Applications | FC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 461-488 amino acids from the C-terminal region of human STIP1. |
Rabbit polyclonal Phospho-p53(S20) Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S20 of human p53. |
| Modifications | Phospho-specific |
Mouse Monoclonal FEN-1 Antibody
| Applications | IF, WB |
| Reactivities | Hamster, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Cyclin B1 phospho S126 antibody
| Applications | WB |
| Reactivities | Human, Rat, Dog, Chimpanzee, Mouse, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 120-131 of Human Cyclin B1 protein. |
Rabbit polyclonal Hsp110 Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Monkey, Mouse, Rat, Sheep, Yeast, Cow |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from the sequence of hamster Hsp110; sequence identical to human and mouse |
Mouse monoclonal anti-PCNA antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Ku80/XRCC5 Antibody
| Applications | IP |
| Reactivities | Hamster, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to residues 323-338 [FSKVDEEQMKYKSEGK] of the 80 kDa Ku80 protein. |
Rabbit Polyclonal Anti-ATIC Antibody
| Applications | WB |
| Reactivities | Hamster, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATIC antibody: synthetic peptide directed towards the N terminal of human ATIC. Synthetic peptide located within the following region: YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG |
Rabbit anti Bak Polyclonal Antibody
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Hamster
Families
- Stem cell - Pluripotency
Filter by
Category
Target Symbol
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
Pathways
- RNA degradation (6)
- Type I diabetes mellitus (6)
- Base excision repair (4)
- Cell cycle (4)
- MAPK signaling pathway (4)
- Antigen processing and presentation (3)
- DNA replication (3)
- Endocytosis (3)
- Non-homologous end-joining (3)
- Spliceosome (3)
- Mismatch repair (2)
- Nucleotide excision repair (2)
- Prion diseases (2)
- p53 signaling pathway (2)
- Amyotrophic lateral sclerosis (ALS) (1)
- Apoptosis (1)
- Basal cell carcinoma (1)
- Bladder cancer (1)
- Chronic myeloid leukemia (1)
- Colorectal cancer (1)
- Endometrial cancer (1)
- Glioma (1)
- Huntington's disease (1)
- Melanoma (1)
- Metabolic pathways (1)
- Neurotrophin signaling pathway (1)
- Non-small cell lung cancer (1)
- One carbon pool by folate (1)
- Oocyte meiosis (1)
- Pancreatic cancer (1)
- Pathways in cancer (1)
- Progesterone-mediated oocyte maturation (1)
- Prostate cancer (1)
- Purine metabolism (1)
- Small cell lung cancer (1)
- Thyroid cancer (1)
- Wnt signaling pathway (1)