Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

Rabbit Polyclonal Anti-G6pc Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI

Rabbit Polyclonal Glut4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human Glucose Transporter GLUT4 protein (between residues 480-509) [UniProt P14672]

Rabbit polyclonal anti-PDE3B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 948 of mouse PDE3B.

Rabbit Polyclonal PTPN1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. In vivo generated recombinant protein fragment

PDE3B (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 400-427 amino acids from the Central region of Human PDE3B

Rabbit Polyclonal PTP1B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PTP1B

USD 320.00

In Stock

Goat Polyclonal Anti-INSR Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide within residues 1310 aa to the C-terminus of human INSR produced in E. coli.

Rabbit polyclonal INSR (Ab-1375) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Stathmin around the phosphorylation site of threonine 1375 (I-L-TP-L-P).

Rabbit polyclonal INSR (Thr1375) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human INSR around the phosphorylation site of threonine 1375 (I-L-TP-L-P).
Modifications Phospho-specific

PDE3A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human
Immunogen PDE3A antibody was raised against synthetic 19 amino acid peptide from near N-terminus of human PDE3A. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (94%).

Rabbit Polyclonal IR Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IR

Rabbit Polyclonal IR (Tyr1355) Antibody (Phospho-specific)

Applications WB
Reactivities Human:Y1355
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IR around the phosphorylation site of Tyrosine 1355
Modifications Phospho-specific

Rabbit Polyclonal Phospho-PTP1B (Ser50) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PTP1B around the phosphorylation site of Serine 50
Modifications Phospho-specific

Rabbit Polyclonal IR Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IR

GLUT4 (SLC2A4) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal PPP1R3A Antibody (Center)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PPP1R3A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 754-782 amino acids from the Central region of human PPP1R3A.

Rabbit Polyclonal IR (Tyr1361) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IR around the phosphorylation site of Tyrosine 1361
Modifications Phospho-specific

Goat Anti-ACACB Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QLGEPDLSDKDRKD, from the internal region of the protein sequence according to NP_001084.2.

PDE3A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human
Immunogen PDE3A antibody was raised against synthetic 18 amino acid peptide from N-terminus of human PDE3A. Percent identity with other species by BLAST analysis: Human (100%); Gibbon, Monkey (94%); Horse (83%).

PDE3A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human, Monkey, Mouse, Rat, Horse, Gibbon
Immunogen PDE3A antibody was raised against synthetic 17 amino acid peptide from internal region of human PDE3A. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Horse, Opossum (100%); Chicken (88%).

Rabbit Polyclonal Anti-SLC2A4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC2A4 Antibody: synthetic peptide directed towards the N terminal of human SLC2A4. Synthetic peptide located within the following region: LQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTTLWALSV

Rabbit Polyclonal Anti-PDE3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE3A antibody: synthetic peptide directed towards the N terminal of human PDE3A. Synthetic peptide located within the following region: LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD

Rabbit Polyclonal Anti-PDE3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE3B antibody: synthetic peptide directed towards the middle region of human PDE3B. Synthetic peptide located within the following region: SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN

Rabbit Polyclonal Anti-INSR Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen INSR / Insulin Receptor antibody was raised against synthetic 16 amino acid peptide from internal region of human Insulin Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Rat, Bovine, Dog, Elephant, Panda (94%); Bat, Horse, Pig (88%); Marmoset (81%).

Mouse anti Insulin Receptor (IR) Monoclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)

Applications FC, IF, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDE3B mouse monoclonal antibody,clone OTI3F5

Applications WB
Reactivities Human
Conjugation Unconjugated

Anti-SLC2A4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 496-509 amino acids of human solute carrier family 2 (facilitated glucose transporter), member 4

Anti-SLC2A4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 496-509 amino acids of human solute carrier family 2 (facilitated glucose transporter), member 4

PPP1R3A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PPP1R3A

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, WB
Reactivities Human, Rat
Conjugation Unconjugated

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, WB
Reactivities Human, Rat
Conjugation Unconjugated

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)

Applications FC, IF, WB
Reactivities Human, Rat
Conjugation Unconjugated

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1A2 (formerly 1A2), Biotinylated

Applications FC, IF, WB
Reactivities Human, Rat
Conjugation Biotin

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1A2 (formerly 1A2), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Rat
Conjugation HRP

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)

Applications FC, IF, WB
Reactivities Human, Rat
Conjugation Unconjugated

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Biotin

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation HRP

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated