Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
USD 524.00
In Stock
Rabbit Monoclonal Antibody against PRNP (Clone EP1802Y)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-PRNP Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRNP |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey |
RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 50-100 of Human RANTES. |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey |
Bax Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Bax |
Prion protein PrP (PRNP) mouse monoclonal antibody, clone EM-20, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Anti-BAX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 90 aa to the N-terminus of human BAX produced in E. coli. |
Rabbit polyclonal anti-BAX antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BAX. |
CCL5 / RANTES Mouse Monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-CCL5 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCL5 |
Rabbit polyclonal anti-Bax antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Bax. |
Mouse Monoclonal anti-Bax Antibody
Applications | IP |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Bax Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Bax Antibody: A synthesized peptide derived from human Bax |
Rabbit Polyclonal Anti-NCAM1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NCAM1 |
Rabbit Polyclonal NCAM Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal anti-BAX antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BAX. |
Rabbit polyclonal Bax (Thr167) antibody(Phospho-specific)
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Bax around the phosphorylation site of threonine 167 (F-G-TP-P-T). |
Modifications | Phospho-specific |
Anti-Human RANTES Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human RANTES (CCL5) |
Rabbit Polyclonal Prion protein Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
BAX rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Bax Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Bax antibody was raised against a peptide corresponding to 16 amino acids near the amino-terminus of human Bax. |
Rabbit polyclonal Bax (Ab-167) antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Bax around the phosphorylation site of threonine 167 (F-G-TP-P-T) |
Anti-NCAM1 (CD56) Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.850~854(Q-T-K-E-N)derived from Human CD56(NCAM). |
Rabbit Polyclonal Bax Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Bax. |
Rabbit Polyclonal Anti-C8B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the middle region of human C8B. Synthetic peptide located within the following region: WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA |
Rabbit Polyclonal Anti-C8B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the C terminal of human C8B. Synthetic peptide located within the following region: SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTL |
Rabbit Polyclonal Anti-CCL5 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN |
CD56 (NCAM1) mouse monoclonal antibody, clone B-A19, Azide Free
Applications | FC |
Reactivities | Human |
CD56 (NCAM1) mouse monoclonal antibody, clone B-A19, Purified
Applications | FC |
Reactivities | Human |
CD56 (NCAM1) mouse monoclonal antibody, clone B-A19, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
NCAM2 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CD56 (NCAM1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to the C-teminal end of human CD56 |
BAX (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rabbit, Rat |
Immunogen | Synthetic peptide corresponding to a sequence mapping near the N-terminal of human BAX |
Goat Polyclonal Antibody against Prion Protein (143-153)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SDYEDRYYREN, from the internal region of the protein sequence according to NP_000302.1; NP_898902.1. |
Rabbit polyclonal anti-BAX antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BAX. |
Rabbit polyclonal anti-NCAM2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NCAM2. |
Mouse Monoclonal anti-Bax Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Biotinylated Anti-Human RANTES Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human RANTES (CCL5) |
Rabbit Polyclonal Prion protein Antibody
Applications | WB |
Reactivities | Bovine, Sheep |
Conjugation | Unconjugated |
Immunogen | Amino acids 142-148 of BSE protein were used as the immunogen. |
Rabbit Polyclonal Prion protein Antibody
Applications | WB |
Reactivities | Bovine, Sheep, Avian |
Conjugation | Unconjugated |
Immunogen | Amino acids 162-170 of BSE protein were used as the immunogen. |
Rabbit Polyclonal Prion protein Antibody
Applications | WB |
Reactivities | Bovine, Sheep |
Conjugation | Unconjugated |
Immunogen | Amino acids 217-229 of BSE protein were used as the immunogen. |
Rabbit Polyclonal Anti-NCAM2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NCAM2 antibody: synthetic peptide directed towards the middle region of human NCAM2. Synthetic peptide located within the following region: KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL |
Rabbit Polyclonal Anti-PRNP Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Prnp antibody is: synthetic peptide directed towards the middle region of Mouse Prnp. Synthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF |
Mouse Monoclonal Bax Antibody
Applications | WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Mouse Monoclonal Bax Antibody
Applications | WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Mouse monoclonal Anti-NCAM Clone ERIC-1
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti BAX Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to N-term of human BAX protein. |
Carrier-free (BSA/glycerol-free) NCAM1 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |