Primary Antibodies

View as table Download

NT5E Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NT5E

Adenylate cyclase 1 (ADCY1) (aa 230-280) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 230-280 of Human ADCY 1.

Rabbit Polyclonal Anti-ADCY6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY

GUCY2D (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 540-570 amino acids from the Central region of human GUCY2D / RETGC1

Rabbit Polyclonal p53R2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen p53R2 antibody was raised against a synthetic peptide corresponding to amino acids 2 to 17 of human p53R2 .

Rabbit polyclonal anti-PDE3B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 948 of mouse PDE3B.

ADCY5 (+ADCY6) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 1111-1160 of Human ADCY 5.

PDE3B (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 400-427 amino acids from the Central region of Human PDE3B

Rabbit polyclonal anti-ADCY5/6 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCY5/6.

Rabbit Polyclonal Anti-NT5C3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NT5C3 Antibody: A synthesized peptide derived from human NT5C3

ENPP3 mouse monoclonal antibody, clone NP4D6, Aff - Purified

Applications FC, IF, IHC
Reactivities Human

CD73 (NT5E) (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen NT5E antibody was raised against kLH conjugated synthetic peptide between 520-550 amino acids from the C-terminal region of human CD73 (NT5E).

ENTPD2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 92~122 amino acids from the N-terminal region of Human ENTPD2.

ENTPD3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 499-531 amino acids from the C-terminal region of Human ENTPD3.

Rabbit Polyclonal antibody to ENTPD6 (ectonucleoside triphosphate diphosphohydrolase 6 (putative function))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 114 and 285 of ENTPD6

Rabbit Polyclonal Adenylate Cyclase 3 Antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Raised against a 20 amino acid peptide corresponding to the C-terminus of rat Adenylate Cyclase 3 (PAAFPNGSSVTLPHQVVDNP).

Goat Anti-ENPP1 / PC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KTHLPTFSQED, from the C Terminus of the protein sequence according to NP_006199.2.

Rabbit polyclonal anti-ADCY5/ADCY6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthetic peptide derived from internal of human ADCY5/ADCY6. (UniProt O95622 and O43306).

Rabbit polyclonal anti-ADCY8 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCY8.

PDE3A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human
Immunogen PDE3A antibody was raised against synthetic 19 amino acid peptide from near N-terminus of human PDE3A. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (94%).

ENPP3 mouse monoclonal antibody, clone NP4D6, PE

Applications FC, IF
Reactivities Human
Conjugation PE

ADCY2 (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 458-489 amino acids from the Central region of human ADCY2

ADCY4 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 421~450 amino acids from the Central region of human ADCY4

Rabbit Polyclonal T-cadherin Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen T-cadherin antibody was raised against a 15 amino acid peptide from near the amino terminus of human T-cadherin.

Rabbit polyclonal antibody to ENTPD5(CD39L4) (ectonucleoside triphosphate diphosphohydrolase 5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 191 of ENTPD5 (Uniprot ID#O75356)

Rabbit polyclonal antibody to ENTPD3 (ectonucleoside triphosphate diphosphohydrolase 3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 200 and 459 of ENTPD3 (Uniprot ID#O75355)

Rabbit anti-ADCY6 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH

Rabbit polyclonal anti-ADCY1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCY1.

Rabbit polyclonal anti-RRM2B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human RRM2B.

ENTPD2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen ENTPD2 antibody was raised against synthetic 17 amino acid peptide from internal region of human ENTPD2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Panda, Dog, Horse (94%); Marmoset, Mouse, Rat, Hamster, Elephant, Bovine (88%); Opossum, Xenopus (82%).

Rabbit polyclonal RRM2B p53R2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-Human RRM2B/p53R2 antibody was prepared by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human RRM2B1 protein. A residue of cysteine was added to facilitate coupling.

Mouse monoclonal CD73(NT5E) Antibody (C-term)(Ascites)

Applications WB
Reactivities Human
Conjugation Unconjugated

CD73 (NT5E) mouse monoclonal antibody, clone AD2, Purified

Applications FC
Reactivities Human

CD39 (ENTPD1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit anti-ADCY2 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH

Rabbit anti-ADCY9 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH

Rabbit polyclonal anti-NT5E antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human NT5E.

Rabbit polyclonal anti-ADCY4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCY4.

CD203c Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Dog, Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset, Dog (100%); Bovine, Horse, Pig (95%); Panda, Bat (84%).

CD203c Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Orang-Utan
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from C-Terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan (100%); Chimpanzee (95%); Gibbon, Hamster (89%); Monkey (84%).

CD203c Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Monkey (100%); Gibbon (95%); Rat, Rabbit, Pig (80%).

CD203c Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Human
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Orangutan, Marmoset (95%); Horse, Rabbit (84%).

PDE3A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human
Immunogen PDE3A antibody was raised against synthetic 18 amino acid peptide from N-terminus of human PDE3A. Percent identity with other species by BLAST analysis: Human (100%); Gibbon, Monkey (94%); Horse (83%).

PDE3A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human, Monkey, Mouse, Rat, Horse, Gibbon
Immunogen PDE3A antibody was raised against synthetic 17 amino acid peptide from internal region of human PDE3A. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Horse, Opossum (100%); Chicken (88%).

ENTPD2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen ENTPD2 antibody was raised against synthetic 18 amino acid peptide from internal region of human ENTPD2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (94%); Gibbon, Bovine (89%); Elephant, Panda (83%).

ENTPD2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Chimpanzee, Human, Monkey, Orang-Utan, Gorilla, Gibbon
Immunogen ENTPD2 antibody was raised against synthetic 15 amino acid peptide from internal region of human ENTPD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Galago, Hamster (80%).

ENTPD2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Human, Monkey
Conjugation Unconjugated
Immunogen ENTPD2 antibody was raised against synthetic 14 amino acid peptide from internal region of human ENTPD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gibbon, Monkey (100%); Gorilla, Bovine, Horse (93%); Galago, Elephant, Guinea pig (86%).

Rabbit Polyclonal Anti-NT5C3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NT5C3 antibody: synthetic peptide directed towards the middle region of human NT5C3. Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII

Rabbit Polyclonal Anti-ENTPD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENTPD6 Antibody is: synthetic peptide directed towards the C-terminal region of Human ENTPD6. Synthetic peptide located within the following region: ALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSP

Rabbit Polyclonal Anti-PDE3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE3A antibody: synthetic peptide directed towards the N terminal of human PDE3A. Synthetic peptide located within the following region: LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD