Rabbit anti-LTA4H polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human Leukotriene A4 hydrolase. |
Rabbit anti-LTA4H polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human Leukotriene A4 hydrolase. |
Rabbit polyclonal anti-PLA2G4E antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PLA2G4E. |
PLA2G3 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Immunogen | PLA2G3 antibody was raised against synthetic 16 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Rat, Dog, Hamster (94%); Elephant, Panda, Rabbit (88%); Bovine, Horse, Pig (81%). |
PLA2G3 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Gorilla, Human, Monkey, Pig |
Conjugation | Unconjugated |
Immunogen | PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%). |
Anti-PTGS1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide (KLH-coupled) derived from human PTGS1 |
Rabbit polyclonal Anti-LTC4S Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LTC4S antibody: synthetic peptide directed towards the N terminal of human LTC4S. Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY |
Rabbit polyclonal Anti-GGTL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GGTL3 antibody: synthetic peptide directed towards the C terminal of human GGTL3. Synthetic peptide located within the following region: ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC |
Rabbit Polyclonal Anti-PLA2G12B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PLA2G12B Antibody is: synthetic peptide directed towards the N-terminal region of Human PLA2G12B. Synthetic peptide located within the following region: LVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELL |
Rabbit Polyclonal Anti-PLA2G2C Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-PLA2G2C antibody is: synthetic peptide directed towards the middle region of Human PLA2G2C. Synthetic peptide located within the following region: LGDKGIPVDDTDSPSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTL |
Rabbit polyclonal Anti-ALOX15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALOX15 antibody: synthetic peptide directed towards the middle region of human ALOX15. Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL |
Rabbit Polyclonal Anti-PTGIS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTGIS antibody: synthetic peptide directed towards the middle region of human PTGIS. Synthetic peptide located within the following region: EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS |
Rabbit Polyclonal Anti-ALOX12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ALOX12 Antibody: synthetic peptide directed towards the C terminal of human ALOX12. Synthetic peptide located within the following region: MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF |
Rabbit Polyclonal Anti-PTGES2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTGES2 antibody is: synthetic peptide directed towards the N-terminal region of Human PTGES2. Synthetic peptide located within the following region: KEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADDWLVHLISPN |
Rabbit Polyclonal Anti-PTGES2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTGES2 antibody is: synthetic peptide directed towards the middle region of Human PTGES2. Synthetic peptide located within the following region: VAKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKDRPFMG |
Rabbit Polyclonal Anti-PLA2G3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLA2G3 antibody is: synthetic peptide directed towards the C-terminal region of Human PLA2G3. Synthetic peptide located within the following region: QRRHQLQDKGTDERQPWPSEPLRGPMSFYNQCLQLTQAARRPDRQQKSWS |
Rabbit Polyclonal Anti-TBXAS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: LDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIV |
Rabbit Polyclonal Anti-CBR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CBR1 antibody: synthetic peptide directed towards the middle region of human CBR1. Synthetic peptide located within the following region: AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ |
Rabbit Polyclonal Anti-CBR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CBR1 antibody: synthetic peptide directed towards the C terminal of human CBR1. Synthetic peptide located within the following region: PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW |
Rabbit Polyclonal Anti-PLA2G4B Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-PLA2G4B antibody: synthetic peptide directed towards the N terminal of human PLA2G4B. Synthetic peptide located within the following region: KDHYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVD |
Rabbit Polyclonal Anti-PLA2G2E Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLA2G2E antibody: synthetic peptide directed towards the middle region of human PLA2G2E. Synthetic peptide located within the following region: GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP |
Rabbit Polyclonal Anti-ALOX5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALOX5 antibody is: synthetic peptide directed towards the C-terminal region of Human ALOX5. Synthetic peptide located within the following region: FGQLFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYY |
Rabbit Polyclonal Anti-PLA2G4B Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-PLA2G4B antibody: synthetic peptide directed towards the N terminal of human PLA2G4B. Synthetic peptide located within the following region: AEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRP |
Sheep polyclonal anti-Cytochrome P450 2E1 antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CYP 2E1 |
Rabbit polyclonal anti-Cytochrome P450 (CYP2E1) antibody
Reactivities | Human, Rat |
Immunogen | Cytochrome P450 (CYP2E1) |
Rabbit anti 15-Lox-1 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti 15-Lox-2 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-ALOX5 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 359 amino acids of Human Arachidonate 5-lipoxygenase Arachidonate 5-lipoxygenase |
Anti-ALOX5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 359 amino acids of Human Arachidonate 5-lipoxygenase Arachidonate 5-lipoxygenase |
Anti-PTGDS Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 64-325 amino acids of human prostaglandin D2 synthase 21kDa (brain)prostaglandin D2 synthase 21kDa (brain) |
Anti-PTGDS Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 64-325 amino acids of human prostaglandin D2 synthase 21kDa (brain)prostaglandin D2 synthase 21kDa (brain) |
Anti-PTGDS Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 23-190 amino acids of human prostaglandin D2 synthase 21kDa (brain) |
Anti-PTGS1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 586-599 amino acids of Human prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) |
Anti-PTGS1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 586-599 amino acids of Human prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) |
Anti-ALOX15B Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 30-351 amino acids of human arachidonate 15-lipoxygenase, type B |
Anti-PTGES2 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 90-377 amino acids of human prostaglandin E synthase 2 |
Anti-PTGES2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 90-377 amino acids of human prostaglandin E synthase 2 |
Rabbit Polyclonal Anti-CBR1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CBR1 |
Rabbit Polyclonal Anti-PLA2G4A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PLA2G4A |
Rabbit Polyclonal Anti-CYP2C9 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP2C9 |
Rabbit Polyclonal Anti-CYP2E1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP2E1 |
Rabbit Polyclonal Anti-TBXAS1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TBXAS1 |
Rabbit Polyclonal Anti-CYP4A11 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP4A11 |
Rabbit Polyclonal Anti-GGT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GGT1 |
Rabbit Polyclonal Anti-LTA4H Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LTA4H |
Rabbit Polyclonal Anti-ALOX15 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ALOX15 |
USD 345.00
In Stock
Rabbit Polyclonal Anti-PLA2G6 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PLA2G6 |
Rabbit Polyclonal Anti-CYP2B6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CYP2B6 |