Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-K6PP / PFKP antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human K6PP. |
Primary Antibodies
View as table Download
Rabbit polyclonal anti-K6PL antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human K6PL. |
Rabbit polyclonal anti-ALDOA antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human ALDOA. |
Rabbit polyclonal Pyruvate Kinase (PKM2) Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This Pyruvate Kinase (PKM2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-505 amino acids from the C-terminal region of human Pyruvate Kinase (PKM2). |
Rabbit polyclonal Aldolase (ALDOA) Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Aldolase (ALDOA) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 66-95 amino acids from the N-terminal region of human Aldolase (ALDOA). |
Rabbit polyclonal AKR1A1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human AKR1A1. |
Rabbit Polyclonal GAPDH antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GAPDH |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | The epitope recognized by this antibody maps to a region between residues 150 and 200 of human GAPDH using the numbering given in entry NP_002037.2 (GeneID 2597). |
GAPDH mouse monoclonal antibody, clone H8, Purified
| Applications | ELISA, WB |
| Reactivities | Bacteria, Human, Insect, Mouse, Rabbit, Rat, Yeast |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against PGAM1 / PGAM2 / PGAM4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KAMEAVAAQGKAKK, from the C Terminus of the protein sequence according to NP_002620.1; NP_000281.2; NP_001025062.1. |
Anti-ENO3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.49~53(L-R-D-G-D) derived from Human β-Enolase(ENO-3). |
Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II). |
Rabbit Polyclonal Pyruvate Dehydrogenase E1-alpha subunit [p Ser293] Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the phosphorylated serine 293 of the human Pyruvate Dehydrogenase E1-alpha subunit protein. [Swiss-Prot #P08559] |
Goat Polyclonal Antibody against PCK2 / PEPCK-M
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KPWKPGDKEPCAH, from the internal region of the protein sequence according to NP_004554.2. |
Goat Polyclonal Antibody against ADH1A, B, C
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence STAGKVMKCKA, from the N Terminus of the protein sequence according to NP_000658.1; NP_000659.2; NP_000660.1. |
Goat Anti-PCK1 / PEPCKC (internal) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HVNWFRKDKEGK, from the internal region of the protein sequence according to NP_002582.3. |
Goat Anti-ADH5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KKIKVDEFVTHN, from the internal region of the protein sequence according to NP_000662.3 . |
Rabbit Polyclonal Aldh3A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Aldh3A1 antibody was raised against a 13 amino acid peptide near the carboxy terminus of the human Aldh3A1. |
Chicken Polyclonal GAPDH Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GAPDH antibody was raised against a 16 amino acid peptide from near the amino terminus of human GAPDH. |
Rabbit anti-AKR1A1 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Goat Anti-ALDH1B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKEQFERVLGYIQ, from the interral region of the protein sequence according to NP_000683.3. |
Goat Anti-ALDH3B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QDLHKSAFESEVSE, from the internal region of the protein sequence according to NP_000685.1. |
Rabbit polyclonal anti-PEPCK-C antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surroundign amino acid 507 of mouse PEPCK-C |
Anti-PDHA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 30-390 amino acids of human pyruvate dehydrogenase (lipoamide) alpha 1 |
Anti-LDHB Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide (KLH-coupled) derived from human LDHB |
Rabbit anti-ENO2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ENO2 |
ALDOA Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | internal region (near N terminus) (NSLACQGKYTPSGQ) |
ALDOA (aa86-96) Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Internal region (QKADDGRPFPQ) |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Drosophila, Feline, Porcine, Protozoa |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 73-87 PITIFQERDPSKIKW of glyceraldehyde 3-phosphate dehydrogenase protein were used as the immunogen. |
Mouse Monoclonal ALDH2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey, Hamster |
| Conjugation | Unconjugated |
Mouse Monoclonal Hexokinase 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GAPDH Antibody (biotin)
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Biotin-GAPDH antibody was raised against a synthetic peptide containing 16 amino acids near the carboxy terminus of GAPDH. |
Rabbit Polyclonal Anti-GAPDH Antibody (HRP)
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | HRP-GAPDH antibody was raised against a synthetic peptide containing 16 amino acids near the carboxy terminus of GAPDH. |
Mouse Monoclonal Anti-GAPDH Antibody [12D3D5]
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-GAPDH Antibody [12D3D5] (biotin)
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Rat
Pathways
- Glycolysis / Gluconeogenesis
Filter by
Category
Target Symbol
- PFKP (52)
- AKR1A1 (51)
- PGAM2 (51)
- ACSS2 (50)
- GAPDH (42)
- PKLR (40)
- DLD (37)
- ALDH3A2 (30)
- GPI (30)
- ADH5 (28)
- ALDOB (24)
- ALDH1A3 (20)
- GALM (20)
- ENO2 (18)
- ADH7 (15)
- PDHA1 (14)
- HK2 (13)
- ALDH2 (10)
- ALDH7A1 (10)
- ADH1B (8)
- ALDH3B1 (8)
- GCK (8)
- ALDOA (7)
- PKM (6)
- HK1 (5)
- PCK1 (5)
- ALDH3A1 (4)
- ALDH9A1 (4)
- ENO1 (4)
- ADH1A (3)
- PFKL (3)
- PGAM1 (3)
- ADH4 (2)
- LDHA (2)
- LDHB (2)
- PFKM (2)
- PGK1 (2)
- TPI1 (2)
- ALDH1B1 (1)
- BPGM (1)
- DLAT (1)
- ENO3 (1)
- FBP1 (1)
- FBP2 (1)
- HK3 (1)
- PCK2 (1)
- PGK2 (1)