Germany
Japan
United Kingdom
China
Primary Antibodies
Download
CD21 (CR2) mouse monoclonal antibody, clone BB6-11C9.6, Purified
| Applications | FC, IHC, IP |
| Reactivities | Porcine |
USD 300.00
In Stock
Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
Goat Anti-CD20 / MS4A1 (C Terminus) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CQDQESSPIENDSSP, from the C Terminus of the protein sequence according to NP_068769.2; NP_690605.1. |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
CD59 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD59 |
Rabbit anti-CD1D Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD1D |
TMEM16A (ANO1) mouse monoclonal antibody, clone DOG1.1, Supernatant
| Applications | IHC |
| Reactivities | Human |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
USD 515.00
In Stock
Anti-HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha |
CD4 mouse monoclonal antibody, clone EDU-2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
Flt3 ligand (FLT3LG) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 180-230 of Human Flt3-L. |
IL5RA rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide, corresponding to amino acids 50-100 of Human IL-5Rα. |
Rabbit polyclonal CSFR (Ab-809) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CSFR around the phosphorylation site of tyrosine 809 (S-N-YP-I-V). |
Rabbit anti-EPO Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EPO |
Rabbit anti-TFRC Polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFRC |
Rabbit Polyclonal Integrin alpha M/CD11b Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region (within residues 250-350) of the mouse CD11b protein. [Swiss-Prot# P05555] |
CD21 (CR2) mouse monoclonal antibody, clone BB6-11C9.6, PE
| Applications | FC |
| Reactivities | Porcine |
| Conjugation | PE |
Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
USD 540.00
2 Weeks
Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, PerCP-Cy5.5
| Applications | FC |
| Reactivities | Human |
| Conjugation | PerCP-Cy5.5 |
Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD3E mouse monoclonal antibody, clone UCHT1, Azide Free
| Applications | FC, FN, IHC, IP |
| Reactivities | Human, Monkey |
CD8A mouse monoclonal antibody, clone CT6, Supernatant
| Applications | FC, IHC |
| Reactivities | Guinea Pig |
Rabbit Polyclonal Antibody against CSF1R
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MCSF Receptor (CSF1R) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 940-971 amino acids from the C-terminal region of human MCSF Receptor (CSF1R). |
Rabbit polyclonal IL-9R (Ser519) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-9R around the phosphorylation site of serine 519 (A-R-SP-W-T). |
| Modifications | Phospho-specific |
Mouse Anti-Human CD34 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRA |
Rabbit anti-CD3E Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD3E |
IL1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL1A |
Rabbit Polyclonal TdT Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti-ANPEP Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ANPEP |
Rabbit Polyclonal Anti-CD1E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD1E antibody is: synthetic peptide directed towards the C-terminal region of Human CD1E. Synthetic peptide located within the following region: WVMWMRGEQEQRGTQRGDVLPNADETWWIFHLSHPDLFDCDSYPGHIGCS |
Active filters
Pathways
- Hematopoietic cell lineage
Filter by
Target Symbol
- CD4 (232)
- CD5 (208)
- CD44 (105)
- KIT (93)
- MS4A1 (90)
- CD19 (86)
- CD33 (84)
- CD8A (68)
- CD1C (67)
- CD34 (65)
- CD22 (64)
- CSF3 (60)
- TNF (60)
- CSF2 (59)
- CR2 (57)
- CD2 (54)
- FCER2 (48)
- CD14 (47)
- MME (45)
- IL6 (42)
- FCGR1A (40)
- IL1A (38)
- CD3E (36)
- ITGB3 (35)
- ANPEP (34)
- CD38 (34)
- CD36 (32)
- KITLG (31)
- CSF1 (29)
- IL2RA (29)
- CSF2RA (26)
- IL3RA (25)
- CSF1R (23)
- IL1B (23)
- IL4 (23)
- ITGAM (21)
- EPOR (18)
- TFRC (18)
- CD7 (17)
- FLT3 (17)
- CD9 (15)
- IL3 (15)
- IL7 (14)
- CD59 (13)
- IL6R (13)
- ITGA6 (13)
- CR1 (11)
- EPO (11)
- ITGA4 (11)
- CD1A (10)
- CD55 (10)
- FLT3LG (10)
- GYPA (10)
- ITGA2 (9)
- ITGA5 (9)
- BMP2 (8)
- IL1R2 (8)
- IL5 (8)
- IL11 (7)
- ITGA3 (7)
- THPO (7)
- CD1D (6)
- CD3D (6)
- HLA-DRB5 (6)
- IL11RA (6)
- TPO (6)
- CD8B (5)
- CSF3R (5)
- DNTT (5)
- IL1R1 (5)
- IL4R (5)
- CD1B (4)
- CD37 (4)
- GP1BA (4)
- HLA-DRA (4)
- ITGA2B (4)
- CD1E (3)
- HLA-DRB3 (3)
- IL5RA (3)
- IL7R (3)
- GP1BB (2)
- GP9 (2)
- IL9R (2)
- ITGA1 (2)
- CD3G (1)
- GP5 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)
Reactivities
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (2354)
- Transmembrane (2166)
- ES Cell Differentiation/IPS (1064)
- Adult stem cells (633)
- Secreted Protein (609)
- Embryonic stem cells (333)
- Induced pluripotent stem cells (274)
- Cancer stem cells (212)
- Protein Kinase (133)
- Stem cell relevant signaling - DSL/Notch pathway (105)
- Protease (97)
- Stem cell - Pluripotency (93)
- Transcription Factors (60)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (8)