Primary Antibodies

View as table Download

Rabbit anti-SHMT2 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SHMT2

Goat Polyclonal Antibody against MTR

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-VEKWLGPILGYDTD, from the C Terminus of the protein sequence according to NP_000245.

Rabbit Monoclonal antibody against DHFR

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse Monoclonal 58K Golgi Protein Antibody (58K-9)

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken
Conjugation Unconjugated

ALDH1L1 mouse monoclonal antibody, clone 3E9, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse

Rabbit Polyclonal antibody to FTCD (formiminotransferase cyclodeaminase)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 251 of FTCD (Uniprot ID#O95954)

Rabbit anti-DHFR Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human DHFR

ALDH1L1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2A6

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700395

USD 320.00

In Stock

Goat Polyclonal Anti-FTCD Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 50 aa to the N-terminus of human FTCD produced in E. coli.

GART mouse monoclonal antibody, clone 4D6-1D5

Applications ELISA, IF, IHC, WB
Reactivities Human

Rabbit polyclonal antibody to MTHFR (5,10-methylenetetrahydrofolate reductase (NADPH))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 21 and 248 of MTHFR (Uniprot ID#P42898)

Anti-DHFR Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit anti-ATIC Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ATIC

Rabbit Polyclonal Anti-MTR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTR antibody: synthetic peptide directed towards the C terminal of human MTR. Synthetic peptide located within the following region: GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL

FTCD Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4A7

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700443

SHMT1 (374-483) mouse monoclonal antibody, clone 4F9, Purified

Applications ELISA, IHC, WB
Reactivities Human

Rabbit polyclonal antibody to ATIC (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 310 and 580 of ATIC (Uniprot ID#P31939)

Rabbit polyclonal MTHFD2 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MTHFD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 271-299 amino acids from the C-terminal region of human MTHFD2.

Rabbit Polyclonal Anti-MTHFD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the N terminal of human MTHFD1. Synthetic peptide located within the following region: RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD

FTCD Capture mouse monoclonal antibody, Luminex validated, clone OTI8C2

Applications LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700443

DHFR / DHFRP1 mouse monoclonal antibody, clone AT5B2, Purified

Applications ELISA, WB
Reactivities Human

DHFR / DHFRP1 mouse monoclonal antibody, clone AT5B2, Purified

Applications ELISA, WB
Reactivities Human

Goat Polyclonal Antibody against FTCD (Internal region)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CLREQGRGKDQPGRL, from the internal region of the protein sequence according to NP_006648.1; NP_996848.1.

Goat Polyclonal Antibody against MTHFR (aa369-383)

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRPKSYIYRTQEWDE, from the internal region of the protein sequence according to NP_005948.3.

Rabbit Polyclonal Anti-ATIC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATIC antibody: synthetic peptide directed towards the middle region of human ATIC. Synthetic peptide located within the following region: RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the N terminal of human SHMT2. Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the C terminal of human SHMT2. Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE

Rabbit Polyclonal Anti-MTHFD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the middle region of human MTHFD1. Synthetic peptide located within the following region: CMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPG

Rabbit Polyclonal Anti-MTHFD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: EAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYV

ALDH1L1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4C11

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700396

ALDH1L1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI5G8

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700396

ALDH1L1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI7G6

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700395

Aminomethyltransferase (AMT) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human AMT

Goat Polyclonal Antibody against FTCD

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence SQLVECVPNFSEGKNQ, from the N Terminus of the protein sequence according to NP_006648; NP_996848.

Goat Anti-MTHFS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KRCLQHQEVKPYT, from the internal region of the protein sequence according to NP_006432.1.

Goat Anti-MTHFD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence RGDLNDCFIPCTPK, from the internal region of the protein sequence according to NP_005947.2.

Rabbit polyclonal antibody to Thymidylate synthetase (thymidylate synthetase)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 122 and 313 of Thymidylate synthetase (Uniprot ID#P04818)

Goat Anti-MTHFD1L (aa535-538) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-DTNDRFLRKITIGQ, from the internal region of the protein sequence according to NP_056255.2.

Sheep polyclonal Thymidylate Synthase antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-THYMIDYLATE SYNTHASE was purified from rabbit serum after repeated immunizations with recombinant human Thymidylate Synthase (36 kDa) produced in E.coli.

Sheep polyclonal Thymidylate Synthase antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This whole sheep serum was prepared by repeated immunizations with recombinant human Thymidylate Synthase (36 kDa) produced in E.coli.

Rabbit polyclonal Thymidylate Synthase antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with recombinant human Thymidylate Synthase (36 kDa) produced in E.coli.

Anti-SHMT2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 240 amino acids of human serine hydroxymethyltransferase 2 (mitochondrial)

Mouse Monoclonal anti-ATIC Antibody

Applications WB
Reactivities Human, Mouse, Rat, Frog, and Fruit fly
Conjugation Unconjugated

Rabbit polyclonal anti-MTFMT antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTFMT antibody: synthetic peptide directed towards the C terminal of human MTFMT. Synthetic peptide located within the following region: SVMLKKSLTATDFYNGYLHPWYQKNSQAQPSQCRFQTLRLPTKKKQKKTV

Rabbit polyclonal Anti-SHMT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT1 antibody: synthetic peptide directed towards the N terminal of human SHMT1. Synthetic peptide located within the following region: NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG

Rabbit Polyclonal Anti-AMT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AMT Antibody: synthetic peptide directed towards the N terminal of human AMT. Synthetic peptide located within the following region: QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA

Rabbit Polyclonal Anti-GART Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GART antibody: synthetic peptide directed towards the middle region of human GART. Synthetic peptide located within the following region: VLKNGSLTNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDIV

Rabbit Polyclonal Anti-MTHFD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE