Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit Polyclonal GATA3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GATA3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human GATA3. The immunogen is located within amino acids 340 - 390 of GATA3. |
Rabbit Polyclonal Antibody against SOX2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit polyclonal anti-Gli-3 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit polyclonal KLF4 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 394-421 amino acids from the C-terminal region of human KLF4. |
Rabbit polyclonal NeuroD1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NeuroD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-45 amino acids from the N-terminal region of human NeuroD1. |
Rabbit polyclonal KLF4 Antibody (N-term C74)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
Rabbit Polyclonal Antibody against CD9 (Center)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 115-145 amino acids from the Central region of human CD9. |
Rabbit polyclonal SOX-9 (Ser181) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SOX-9 around the phosphorylation site of serine 181 (R-K-SP-V-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GATA3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3. Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS |
Rabbit Polyclonal Antibody against CD14 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CD14. |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Anti-ERBB3 (phospho-Tyr1328) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 1328 (P-D-Y(p)-W-H) derived from Human Her3/ErbB3. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-HDAC1 antibody, Loading control
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This HDAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 70-99 amino acids from the N-terminal region of human HDAC1. |
Rabbit polyclonal IGFBP2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IGFBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the C-terminal region of human IGFBP2. |
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Rabbit polyclonal anti-HDAC-1 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-HDAC-1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 466-482 of Human HDAC-1. |
Rabbit Polyclonal Anti-GATA3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3. Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
EGFR pTyr869 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
Rabbit polyclonal EGFR (Thr678) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 678 (K-R-TP-L-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal LEF1 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LEF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-37 amino acids from the N-terminal region of human LEF1. |
Rabbit polyclonal HDAC1 Antibody (Center S423)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This HDAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 402-430 amino acids from the Central region of human HDAC1. |
Rabbit polyclonal HNF1A Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This HNF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 177-205 amino acids from the Central region of human HNF1A. |
ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified
| Applications | IF |
| Reactivities | Human |
| Immunogen | Synhesized non-phosphopeptide derived from human Her3/ErbB3 around the phosphorylation site of Tyr1289 (Q-G-YPE-E) |
ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified
| Applications | IF |
| Reactivities | Human |
| Immunogen | Synhesized non-phosphopeptide derived from human Her3/ErbB3 around the phosphorylation site of Tyr1289 (Q-G-YPE-E) |
Active filters
Applications
- IF
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Families
- Adult stem cells
Filter by
Category
Target Symbol
Reactivities
Conjugates
Modifications
Pathways
- Pathways in cancer (16)
- Endocytosis (8)
- Calcium signaling pathway (7)
- ErbB signaling pathway (7)
- Basal cell carcinoma (6)
- Hematopoietic cell lineage (6)
- Cell cycle (5)
- Chronic myeloid leukemia (5)
- Cytokine-cytokine receptor interaction (5)
- Hedgehog signaling pathway (5)
- Huntington's disease (5)
- MAPK signaling pathway (5)
- Notch signaling pathway (5)
- Regulation of actin cytoskeleton (5)
- Adherens junction (4)
- Colorectal cancer (4)
- Endometrial cancer (4)
- Maturity onset diabetes of the young (4)
- Melanoma (4)
- Prostate cancer (4)
- Bladder cancer (3)
- Dorso-ventral axis formation (3)
- Epithelial cell signaling in Helicobacter pylori infection (3)
- Focal adhesion (3)
- Gap junction (3)
- Glioma (3)
- GnRH signaling pathway (3)
- Non-small cell lung cancer (3)
- Pancreatic cancer (3)
- Acute myeloid leukemia (2)
- Antigen processing and presentation (2)
- Cell adhesion molecules (CAMs) (2)
- Melanogenesis (2)
- Primary immunodeficiency (2)
- T cell receptor signaling pathway (2)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- ECM-receptor interaction (1)
- Jak-STAT signaling pathway (1)
- Pathogenic Escherichia coli infection (1)
- Thyroid cancer (1)
- Toll-like receptor signaling pathway (1)
- Wnt signaling pathway (1)