Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-FAH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAH antibody: synthetic peptide directed towards the C terminal of human FAH. Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG |
Rabbit Polyclonal Anti-FAH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAH antibody: synthetic peptide directed towards the N terminal of human FAH. Synthetic peptide located within the following region: SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT |
Rabbit polyclonal Tyrosine Hydroxylase (Ab-19) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 19 (A-V-SP-E-Q). |
Rabbit polyclonal Tyrosine Hydroxylase (Ser19)(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 19 (A-V-SP-E-Q). |
| Modifications | Phospho-specific |
Rabbit polyclonal ADH1B Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ADH1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-237 amino acids from the Central region of human ADH1B. |
Rabbit Polyclonal Anti-TYRP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP |
Rabbit polyclonal ADH4 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ADH4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 319-348 amino acids from the C-terminal region of human ADH4. |
Rabbit polyclonal Tyrosine Hydroxylase (Ser31) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 31 (V-T-SP-P-R). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MAOB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV |
Anti-ADH4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human alcohol dehydrogenase 4 (class II), pi polypeptide |
Anti-ALDH3A1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member A1 |
Anti-AOX1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde oxidase 1 |
Anti-ALDH3B1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member B1 |
Anti-ADH1A Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human alcohol dehydrogenase 1A (class I), alpha polypeptide |
Anti-DCT Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 222-472 amino acids of human dopachrome tautomerase |
Rabbit Polyclonal Anti-DBH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DBH |
Rabbit Polyclonal Anti-GOT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GOT2 |
Active filters
Reactivities
- Mouse
Applications
- IHC
Antibody Hosts
- Rabbit
Isotypes
- IgG
Pathways
- Tyrosine metabolism