Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 450.00
2 Weeks
Rabbit Polyclonal antibody to NDUFV2 (NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 249 of NDUFV2 (Uniprot ID#P19404) |
Rabbit Polyclonal antibody to NDUFV1 (NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 218 and 459 of NDUFV1 (Uniprot ID#P49821) |
Rabbit Polyclonal antibody to NDUFA5 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 116 of NDUFA5 (Uniprot ID#Q16718) |
Rabbit Polyclonal antibody to ATP synthase delta (ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 168 of ATP synthase delta (Uniprot ID#P30049) |
Rabbit Polyclonal antibody to NDUFB9 (NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 162 of NDUFB9 |
Rabbit polyclonal anti-ATP6V1H antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP6V1H. |
Rabbit Polyclonal Anti-COX15 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COX15 antibody: synthetic peptide directed towards the N terminal of human COX15. Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY |
Rabbit polyclonal anti-COX5B antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COX5B. |
Rabbit polyclonal anti-NDUC2 antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUC2. |
Rabbit polyclonal anti-NDUFS6 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFS6. |
Rabbit polyclonal anti-NDUFV3 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFV3. |
Anti-COX6B1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-COX7B Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-79 amino acids of human cytochrome c oxidase subunit VIIb |
Anti-COX10 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 300 amino acids of Human COX10 homolog, cytochrome c oxidase assembly protein, heme A: farnesyltransferase |
Rabbit Polyclonal Anti-NDUFA9 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NDUFA9 |
Rabbit Polyclonal Anti-NDUFA5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NDUFA5 |
Rabbit Polyclonal Anti-NDUFA9 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NDUFA9 |
Rabbit Polyclonal Anti-NDUFA2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NDUFA2 |
Rabbit Polyclonal Anti-NDUFS5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NDUFS5 |
Rabbit Polyclonal Anti-NDUFS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NDUFS1 |
Rabbit Polyclonal Anti-NDUFS7 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NDUFS7 |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Pathways
- Oxidative phosphorylation
Filter by
Category
Target Symbol
- COX4I1 (6)
- ATP5PF (4)
- COX6B1 (4)
- NDUFA10 (4)
- NDUFA8 (3)
- NDUFB9 (3)
- NDUFS1 (3)
- NDUFS2 (3)
- NDUFS4 (3)
- NDUFS8 (3)
- SDHA (3)
- ATP5F1A (2)
- ATP5F1D (2)
- ATP6V1B1 (2)
- COX10 (2)
- COX17 (2)
- COX5A (2)
- COX5B (2)
- COX7B (2)
- COX7B2 (2)
- NDUFA5 (2)
- NDUFA9 (2)
- NDUFAB1 (2)
- NDUFC2 (2)
- NDUFS5 (2)
- NDUFS6 (2)
- NDUFV2 (2)
- SDHB (2)
- SDHD (2)
- ATP5F1B (1)
- ATP5F1C (1)
- ATP5MC2 (1)
- ATP5MC3 (1)
- ATP5MF (1)
- ATP5PD (1)
- ATP6V0A2 (1)
- ATP6V0B (1)
- ATP6V1A (1)
- ATP6V1H (1)
- COX11 (1)
- COX15 (1)
- COX6A1 (1)
- COX6A2 (1)
- COX6B2 (1)
- COX7A2 (1)
- COX7A2L (1)
- COX8A (1)
- LCMT2 (1)
- MTND1 (1)
- NDUFA1 (1)
- NDUFA11 (1)
- NDUFA2 (1)
- NDUFA3 (1)
- NDUFA4 (1)
- NDUFB1 (1)
- NDUFB10 (1)
- NDUFB5 (1)
- NDUFS3 (1)
- NDUFS7 (1)
- NDUFV1 (1)
- NDUFV3 (1)
- PPA1 (1)
- UQCR10 (1)
- UQCRB (1)
- UQCRC1 (1)
- UQCRC2 (1)
- UQCRFS1 (1)