Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-E2F6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human E2F6 |
TA349302 is a possible alternative to TA324290.
Rabbit Polyclonal Anti-PHB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHB |
TA349430 is a possible alternative to TA322982.
Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the C terminal of human HNRPD. Synthetic peptide located within the following region: YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP |
Rabbit polyclonal anti-MBTPS1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Anti-KEAP1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human kelch-like ECH-associated protein 1 |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal GR (Ab-211) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W). |
Rabbit polyclonal MITF (Ab-180/73) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M). |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit polyclonal anti-NR1I2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NR1I2. |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
USD 345.00
In Stock
Rabbit polyclonal anti-KAP0 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human KAP0. |
Rabbit polyclonal anti-HOXC6 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human HOXC6. |
Rabbit polyclonal RUNX1 Antibody (S276)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RUNX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 227-255 amino acids from human RUNX1. |
Rabbit polyclonal KLF5 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This KLF5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 341-370 amino acids from the C-terminal region of human KLF5. |
Rabbit Polyclonal STAT5A (Ser780) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT5A around the phosphorylation site of Serine 780 |
| Modifications | Phospho-specific |
Rabbit Polyclonal STAT5A/B (Ser725/730) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT5A/B around the phosphorylation site of Serine 725/730 |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-Elongin C Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant full-length |
Rabbit anti-NFKB2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human NFKB2 |
Rabbit Polyclonal Anti-CREB3L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREB3L1 antibody: synthetic peptide directed towards the N terminal of human CREB3L1. Synthetic peptide located within the following region: MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDF |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Transcription Factors
Availabilities
- In Stock
Filter by
Target Symbol
- JUN (14)
- TP53 (13)
- NR3C1 (12)
- RELA (11)
- ATF2 (10)
- CREB1 (8)
- FOXO1 (8)
- IKBKG (8)
- NFKB1 (8)
- RUNX1 (8)
- STAT5A (8)
- CTNNB1 (7)
- ESR1 (7)
- RPS6KA5 (7)
- STAT1 (7)
- ABL1 (6)
- ELK1 (6)
- HDAC1 (6)
- SMAD1 (6)
- SMAD3 (6)
- BRCA1 (5)
- CCNE1 (5)
- HDAC2 (5)
- IRF3 (5)
- MDM2 (5)
- NFKB2 (5)
- RB1 (5)
- SRF (5)
- STAT3 (5)
- STAT5B (5)
- AHR (4)
- CBL (4)
- FOS (4)
- FOXO4 (4)
- GATA1 (4)
- GATA4 (4)
- HDAC3 (4)
- HSF1 (4)
- IKBKB (4)
- JUND (4)
- MAP2K3 (4)
- MITF (4)
- MYB (4)
- NFKBIE (4)
- SIRT2 (4)
- TP73 (4)
- APEX1 (3)
- ATF1 (3)
- CDX2 (3)
- CEBPD (3)
- ESR2 (3)
- GATA3 (3)
- HDAC4 (3)
- HDAC5 (3)
- HMGB1 (3)
- HNF1B (3)
- HNRNPD (3)
- HOXA11 (3)
- HSF2 (3)
- JUNB (3)
- KLF4 (3)
- MED1 (3)
- MEF2A (3)
- NFATC3 (3)
- NFKBIB (3)
- NPM1 (3)
- NRG1 (3)
- PAWR (3)
- PAX5 (3)
- PGR (3)
- PPARA (3)
- PRKCQ (3)
- RAN (3)
- REL (3)
- SMAD2 (3)
- SOX2 (3)
- STAT2 (3)
- STAT4 (3)
- STAT6 (3)
- TRIM32 (3)
- VAV1 (3)
- AATF (2)
- AR (2)
- ARNT (2)
- ATF4 (2)
- BAZ1B (2)
- BCL6 (2)
- BCLAF1 (2)
- CBX3 (2)
- CBX6 (2)
- CBX8 (2)
- CCNC (2)
- CCNH (2)
- CEBPE (2)
- CERS2 (2)
- COPS5 (2)
- CRK (2)
- CUX1 (2)
- DDIT3 (2)
- DLX3 (2)
Reactivities
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (205)
- MAPK signaling pathway (122)
- Chronic myeloid leukemia (111)
- Prostate cancer (97)
- Neurotrophin signaling pathway (82)
- Cell cycle (80)
- Pancreatic cancer (77)
- T cell receptor signaling pathway (73)
- Small cell lung cancer (68)
- Acute myeloid leukemia (67)
- B cell receptor signaling pathway (66)
- Toll-like receptor signaling pathway (65)
- Wnt signaling pathway (64)
- Chemokine signaling pathway (61)
- Adipocytokine signaling pathway (53)
- Colorectal cancer (53)
- ErbB signaling pathway (50)
- Huntington's disease (48)
- Jak-STAT signaling pathway (47)
- Apoptosis (46)
- Epithelial cell signaling in Helicobacter pylori infection (45)
- Cytosolic DNA-sensing pathway (42)
- RIG-I-like receptor signaling pathway (40)
- Bladder cancer (36)
- NOD-like receptor signaling pathway (34)
- Endometrial cancer (33)
- Focal adhesion (32)
- Melanoma (31)
- TGF-beta signaling pathway (30)
- Thyroid cancer (29)
- Ubiquitin mediated proteolysis (29)
- Insulin signaling pathway (28)
- p53 signaling pathway (28)
- Glioma (27)
- Non-small cell lung cancer (27)
- GnRH signaling pathway (26)
- Melanogenesis (26)
- Adherens junction (25)
- Basal cell carcinoma (24)
- Renal cell carcinoma (24)
- Amyotrophic lateral sclerosis (ALS) (18)
- Metabolic pathways (18)
- Endocytosis (16)
- Tight junction (16)
- Notch signaling pathway (15)
- Pathogenic Escherichia coli infection (15)
- Neuroactive ligand-receptor interaction (14)
- Axon guidance (13)
- Oocyte meiosis (13)
- Basal transcription factors (12)
- Antigen processing and presentation (11)
- DNA replication (11)
- Leukocyte transendothelial migration (11)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (10)
- Natural killer cell mediated cytotoxicity (10)
- Maturity onset diabetes of the young (9)
- Primary immunodeficiency (9)
- Base excision repair (8)
- Fc epsilon RI signaling pathway (7)
- Nucleotide excision repair (7)
- Purine metabolism (7)
- Pyrimidine metabolism (7)
- VEGF signaling pathway (7)
- Viral myocarditis (7)
- Fc gamma R-mediated phagocytosis (6)
- PPAR signaling pathway (6)
- Prion diseases (6)
- Type II diabetes mellitus (6)
- RNA degradation (5)
- RNA polymerase (5)
- Regulation of actin cytoskeleton (5)
- Long-term potentiation (4)
- Progesterone-mediated oocyte maturation (3)
- Vascular smooth muscle contraction (3)
- Alzheimer's disease (2)
- Circadian rhythm - mammal (2)
- Cytokine-cytokine receptor interaction (2)
- Dorso-ventral axis formation (2)
- Glycolysis / Gluconeogenesis (2)
- Homologous recombination (2)
- Non-homologous end-joining (2)
- Biosynthesis of unsaturated fatty acids (1)
- Calcium signaling pathway (1)
- Glycerolipid metabolism (1)
- Glycine (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Hedgehog signaling pathway (1)
- Long-term depression (1)
- Spliceosome (1)
- Systemic lupus erythematosus (1)
- mTOR signaling pathway (1)
- serine and threonine metabolism (1)