Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit polyclonal anti-MBTPS1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
Rabbit Polyclonal Anti-NOTCH2 (Cleaved-Ala1734) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOTCH2 (Cleaved-Ala1734) Antibody: A synthesized peptide derived from human NOTCH2 (Cleaved-Ala1734) |
Rabbit Polyclonal Anti-Aqp2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Aqp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLV |
Rabbit polyclonal Syndecan4 (Ab-179) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit Polyclonal antibody to Activin A Receptor type IIA (activin A receptor, type IIA)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 267 and 513 of Activin A Receptor type IIA (Uniprot ID#P27037) |
Rabbit polyclonal anti-SPR1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SPR1. |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to Ribosome binding protein 1 (ribosome binding protein 1 homolog 180kDa (dog))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1183 and 1410 of Ribosome binding protein 1 (Uniprot ID#Q9P2E9) |
Rabbit Polyclonal DRAM Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | DRAM antibody was raised against a 16 amino acid synthetic peptide from near the amino terminus of human DRAM. The immunogen is located within amino acids 30 - 80 of DRAM. |
Rabbit Polyclonal antibody to VAPA (VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 29 and 122 of VAPA (Uniprot ID#Q9P0L0) |
Rabbit polyclonal anti-NDUFA4L2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2. |
Rabbit Polyclonal Trk B (Tyr515) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Trk B around the phosphorylation site of Tyrosine 515 (peptide seq 509-521aa: VIENPQY(p)FGITN) |
| Modifications | Phospho-specific |
Rabbit polyclonal CSFR (Ab-809) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CSFR around the phosphorylation site of tyrosine 809 (S-N-YP-I-V). |
Rabbit Polyclonal LY6K Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | LY6K antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human LY6K. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Transmembrane
Availabilities
- In Stock
Filter by
Target Symbol
- EGFR (17)
- GRIN2B (9)
- MET (9)
- FGFR1 (8)
- ERBB2 (7)
- BCL2L1 (6)
- CSF1R (6)
- IGF1R (6)
- APP (5)
- EPHA2 (5)
- NGFR (5)
- PDGFRB (5)
- STX1A (5)
- SYT1 (5)
- CD44 (4)
- CLDN1 (4)
- CLDN7 (4)
- GLRA1 (4)
- NOTCH2 (4)
- ABCD4 (3)
- ACE (3)
- CA14 (3)
- CASR (3)
- CD19 (3)
- CFTR (3)
- CSF2RA (3)
- EDNRA (3)
- EPHA3 (3)
- F10 (3)
- GJA1 (3)
- GRIK1 (3)
- GRM3 (3)
- HAVCR1 (3)
- INSR (3)
- ITGB3 (3)
- KCNA5 (3)
- KDR (3)
- KIT (3)
- LPAR4 (3)
- MUC1 (3)
- NTRK2 (3)
- PTGER2 (3)
- SPAG4 (3)
- ABCB6 (2)
- ACVR2A (2)
- ADAM17 (2)
- ADRA1A (2)
- AIFM1 (2)
- ALCAM (2)
- ALDH6A1 (2)
- ANO1 (2)
- ANTXR1 (2)
- APLNR (2)
- APLP1 (2)
- APLP2 (2)
- AQP1 (2)
- ARMCX2 (2)
- ARMCX3 (2)
- ATP2A1 (2)
- AUP1 (2)
- BACE1 (2)
- BAX (2)
- BCL2 (2)
- BNIP1 (2)
- CA4 (2)
- CADM4 (2)
- CAV1 (2)
- CCR3 (2)
- CDH3 (2)
- CERS2 (2)
- CLDN11 (2)
- COX4I1 (2)
- CRHR2 (2)
- CUX1 (2)
- CX3CR1 (2)
- CYB5A (2)
- CYP3A4 (2)
- DIABLO (2)
- EDA (2)
- EFNB1 (2)
- EFNB3 (2)
- EPHA4 (2)
- EPHB1 (2)
- FLT3 (2)
- FZD4 (2)
- GABRB1 (2)
- GHSR (2)
- GPAT3 (2)
- GPAT4 (2)
- GPR15 (2)
- GRIN1 (2)
- GRM5 (2)
- GRM7 (2)
- GRM8 (2)
- GRPR (2)
- IGF2R (2)
- IL11RA (2)
- IL2RB (2)
- ITGA4 (2)
- ITGB1 (2)
Clonalities
Conjugates
Modifications
Pathways
- Cytokine-cytokine receptor interaction (113)
- Neuroactive ligand-receptor interaction (113)
- Pathways in cancer (105)
- Calcium signaling pathway (71)
- Focal adhesion (68)
- Endocytosis (63)
- Adherens junction (56)
- Colorectal cancer (54)
- Regulation of actin cytoskeleton (53)
- Metabolic pathways (50)
- Prostate cancer (49)
- Melanoma (48)
- MAPK signaling pathway (43)
- Hematopoietic cell lineage (42)
- Cell adhesion molecules (CAMs) (40)
- Alzheimer's disease (38)
- Axon guidance (36)
- Pancreatic cancer (34)
- Gap junction (33)
- Glioma (31)
- Epithelial cell signaling in Helicobacter pylori infection (30)
- ErbB signaling pathway (29)
- Bladder cancer (26)
- Huntington's disease (26)
- Leukocyte transendothelial migration (26)
- Endometrial cancer (25)
- Non-small cell lung cancer (25)
- Amyotrophic lateral sclerosis (ALS) (24)
- Jak-STAT signaling pathway (22)
- Dorso-ventral axis formation (21)
- ABC transporters (20)
- GnRH signaling pathway (20)
- Melanogenesis (20)
- ECM-receptor interaction (18)
- Hypertrophic cardiomyopathy (HCM) (18)
- Tight junction (17)
- Apoptosis (16)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (16)
- Dilated cardiomyopathy (16)
- SNARE interactions in vesicular transport (16)
- Wnt signaling pathway (16)
- Long-term potentiation (15)
- Neurotrophin signaling pathway (15)
- Vascular smooth muscle contraction (15)
- Small cell lung cancer (13)
- Basal cell carcinoma (12)
- Renal cell carcinoma (12)
- Systemic lupus erythematosus (12)
- Chemokine signaling pathway (11)
- Notch signaling pathway (10)
- Parkinson's disease (10)
- Chronic myeloid leukemia (9)
- Long-term depression (9)
- Natural killer cell mediated cytotoxicity (9)
- Oxidative phosphorylation (9)
- Primary immunodeficiency (9)
- Retinol metabolism (9)
- TGF-beta signaling pathway (9)
- Lysosome (7)
- Oocyte meiosis (7)
- Pathogenic Escherichia coli infection (7)
- Progesterone-mediated oocyte maturation (7)
- Renin-angiotensin system (7)
- Vibrio cholerae infection (7)
- Acute myeloid leukemia (6)
- Arachidonic acid metabolism (6)
- Cardiac muscle contraction (6)
- Toll-like receptor signaling pathway (6)
- Viral myocarditis (6)
- p53 signaling pathway (6)
- Complement and coagulation cascades (5)
- Fc gamma R-mediated phagocytosis (5)
- Glycerolipid metabolism (5)
- Glycerophospholipid metabolism (5)
- Insulin signaling pathway (5)
- Metabolism of xenobiotics by cytochrome P450 (5)
- Nitrogen metabolism (5)
- Adipocytokine signaling pathway (4)
- B cell receptor signaling pathway (4)
- Drug metabolism - cytochrome P450 (4)
- Hedgehog signaling pathway (4)
- N-Glycan biosynthesis (4)
- Prion diseases (4)
- T cell receptor signaling pathway (4)
- Androgen and estrogen metabolism (3)
- Antigen processing and presentation (3)
- Biosynthesis of unsaturated fatty acids (3)
- Drug metabolism - other enzymes (3)
- Ether lipid metabolism (3)
- Glycosphingolipid biosynthesis - ganglio series (3)
- Inositol phosphate metabolism (3)
- Linoleic acid metabolism (3)
- PPAR signaling pathway (3)
- Primary bile acid biosynthesis (3)
- Purine metabolism (3)
- Riboflavin metabolism (3)
- Sphingolipid metabolism (3)
- Thyroid cancer (3)
- Type II diabetes mellitus (3)
- VEGF signaling pathway (3)
- Asthma (2)
- Cell cycle (2)
- Fatty acid metabolism (2)
- Fc epsilon RI signaling pathway (2)
- Glutathione metabolism (2)
- Olfactory transduction (2)
- Phosphatidylinositol signaling system (2)
- Porphyrin and chlorophyll metabolism (2)
- Propanoate metabolism (2)
- Pyrimidine metabolism (2)
- Steroid biosynthesis (2)
- Taste transduction (2)
- Tryptophan metabolism (2)
- Tyrosine metabolism (2)
- Valine (2)
- leucine and isoleucine degradation (2)
- Allograft rejection (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Ascorbate and aldarate metabolism (1)
- Autoimmune thyroid disease (1)
- C21-Steroid hormone metabolism (1)
- Cyanoamino acid metabolism (1)
- Cytosolic DNA-sensing pathway (1)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- Graft-versus-host disease (1)
- Heparan sulfate biosynthesis (1)
- Keratan sulfate biosynthesis (1)
- Nicotinate and nicotinamide metabolism (1)
- O-Glycan biosynthesis (1)
- O-Mannosyl glycan biosynthesis (1)
- Pentose and glucuronate interconversions (1)
- RIG-I-like receptor signaling pathway (1)
- Selenoamino acid metabolism (1)
- Starch and sucrose metabolism (1)
- Taurine and hypotaurine metabolism (1)
- Terpenoid backbone biosynthesis (1)
- Ubiquitin mediated proteolysis (1)