Rabbit Polyclonal Anti-ADORA2B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B. |
Rabbit Polyclonal S1P1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1. |
Rabbit Polyclonal Anti-CALCRL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CALCRL antibody: synthetic peptide directed towards the N terminal of human CALCRL. Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL |
Rabbit polyclonal CALCR Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CALCR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 445-474 amino acids from the C-terminal region of human CALCR. |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: LTLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPS |
Rabbit Polyclonal Anti-AGTR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGTR1 antibody: synthetic peptide directed towards the N terminal of human AGTR1. Synthetic peptide located within the following region: ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI |
Rabbit polyclonal antibody to MC1R (melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 253 and 317 of MC1 Receptor (Uniprot ID#Q01726) |
Rabbit Polyclonal GluR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GluR2 |
Rabbit anti-CHRM5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM5 |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR |
Rabbit Polyclonal Anti-NTSR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NTSR1 antibody: synthetic peptide directed towards the N terminal of human NTSR1. Synthetic peptide located within the following region: FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT |
Rabbit Polyclonal Anti-CHRM1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CHRM1 |
Rabbit anti-CHRM1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM1 |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the C terminal of human TSHR. Synthetic peptide located within the following region: KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS |
Rabbit Polyclonal antibody to Histamine H2 Receptor (histamine receptor H2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 45 of Histamine H2 Receptor (Uniprot ID#P25021) |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Rabbit polyclonal anti-CCKBR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CCKBR. |
Rabbit anti-PTH1R Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PTH1R |
P2RY6 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human P2RY6 |
Rabbit anti-DRD1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human DRD1 |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: ELIARNTWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLM |
Rabbit Polyclonal Anti-mGluR8 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-mGluR8 Antibody: A synthesized peptide derived from human mGluR8 |
Rabbit Polyclonal Anti-GRM5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRM5 Antibody: A synthesized peptide derived from internal of human GRM5. |
Rabbit polyclonal antibody to MEL-1A-R (melatonin receptor 1A)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 80 and 172 of Melatonin Receptor 1A (Uniprot ID#P48039) |
Germany
Japan
United Kingdom
China
